BLASTX nr result
ID: Coptis21_contig00014922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014922 (510 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 108 6e-22 emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 93 2e-17 ref|XP_002517741.1| conserved hypothetical protein [Ricinus comm... 85 5e-15 tpg|DAA47075.1| TPA: hypothetical protein ZEAMMB73_027346 [Zea m... 64 1e-08 ref|XP_002535828.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 108 bits (269), Expect = 6e-22 Identities = 57/79 (72%), Positives = 59/79 (74%), Gaps = 1/79 (1%) Frame = +3 Query: 231 YPILESSAELYPARISF*-RGPKKCLHLLPTVFLRNYTERVDPPLPFVLATYPKVSSPRA 407 YPILE SA L PA F + PKK LHLLPTVFL+N ERVDPP FVLATYPKVSS R Sbjct: 6 YPILEPSAGLNPAPPHFLLKRPKKGLHLLPTVFLQNLIERVDPPPHFVLATYPKVSSLRV 65 Query: 408 PRRRQSNQPACCGGAAFLF 464 PRRRQ NQP CCGGA F F Sbjct: 66 PRRRQKNQPVCCGGALFFF 84 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +1 Query: 376 QLILRSPRQELPGDDRATNPPAVAGRLFCFTIRPGRLSLPSVAYE 510 QLILRSPRQELPGDDR TNPPAVAGRLFCFTIRPGRLSLPSVAYE Sbjct: 135 QLILRSPRQELPGDDRGTNPPAVAGRLFCFTIRPGRLSLPSVAYE 179 >ref|XP_002517741.1| conserved hypothetical protein [Ricinus communis] gi|223543139|gb|EEF44673.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 85.1 bits (209), Expect = 5e-15 Identities = 45/63 (71%), Positives = 48/63 (76%) Frame = -1 Query: 459 KKPPRHSRRVGCSVVAGELLARRP*DKLLKQTGGEDRPVQYNSEERLLAAGGDISLAPFK 280 K P HSRRVG S+VAG+LL RRP LKQ G EDRPVQ N EERLLA GGD+SLA FK Sbjct: 37 KIAPHHSRRVGSSIVAGQLLVRRP--YFLKQKGEEDRPVQSNFEERLLAVGGDLSLALFK 94 Query: 279 RKC 271 RKC Sbjct: 95 RKC 97 >tpg|DAA47075.1| TPA: hypothetical protein ZEAMMB73_027346 [Zea mays] Length = 88 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 362 EGRIDPFSIIPKKDCWQQVETFLWPPSK 279 EGRIDPFS IPKKDCWQQVETFLWPPSK Sbjct: 61 EGRIDPFSRIPKKDCWQQVETFLWPPSK 88 >ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis] gi|255608154|ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis] gi|223510119|gb|EEF23533.1| conserved hypothetical protein [Ricinus communis] gi|223521805|gb|EEF26555.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/51 (66%), Positives = 35/51 (68%) Frame = -3 Query: 367 NGRGGSTRSV*FRRKTVGSRWRHFFGPLQKEMRAG*SSAEDSRIG*VGSCP 215 +G GGSTRSV FRRKTVGSRWR FFGPLQKEMR VGSCP Sbjct: 36 DGGGGSTRSVKFRRKTVGSRWRPFFGPLQKEMRGRGVKLGRGFENRVGSCP 86