BLASTX nr result
ID: Coptis21_contig00014752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014752 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531302.1| Disease resistance protein RPM1, putative [R... 58 7e-07 >ref|XP_002531302.1| Disease resistance protein RPM1, putative [Ricinus communis] gi|223529093|gb|EEF31074.1| Disease resistance protein RPM1, putative [Ricinus communis] Length = 440 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/86 (31%), Positives = 49/86 (56%) Frame = +1 Query: 7 KMHDLMHDLACSVMVNDCLSLKIGEIRDVPQKARHVSVTYDSAPSQATLNTIFKSQSFCR 186 KMHD +HDLA S+M ++C +++ ++ +VP+KARH S+ + S N +FK QS Sbjct: 118 KMHDFVHDLAQSIMKDECKLIELNKVSEVPKKARHFSIVRNPEQSSPQSNNLFKDQSLRS 177 Query: 187 TILFHHCATSSLLELFVSRLSQLEYL 264 + + +++ + ++S L L Sbjct: 178 LLWMDYYSSNHRVPSYLSGQKHLRVL 203