BLASTX nr result
ID: Coptis21_contig00014734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014734 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534368.1| lipoxygenase, putative [Ricinus communis] gi... 94 2e-17 gb|AAR84664.1| lipoxygenase [Carica papaya] 89 3e-16 gb|AAF97315.1|AC007843_18 lipoxygenase [Arabidopsis thaliana] 88 6e-16 ref|NP_564021.1| lipoxygenase 3 [Arabidopsis thaliana] gi|752640... 88 6e-16 ref|XP_002890224.1| hypothetical protein ARALYDRAFT_471947 [Arab... 88 6e-16 >ref|XP_002534368.1| lipoxygenase, putative [Ricinus communis] gi|223525418|gb|EEF28014.1| lipoxygenase, putative [Ricinus communis] Length = 445 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -1 Query: 219 KIEKEIERRNSDPKLRNRCGAGVLPYELLTPSSESGVTCRGVPNSVSI 76 +IEKEIERRN DPKLRNRCGAGVLPYELL PSSE GVTCRGVPNSVSI Sbjct: 398 RIEKEIERRNKDPKLRNRCGAGVLPYELLAPSSEPGVTCRGVPNSVSI 445 >gb|AAR84664.1| lipoxygenase [Carica papaya] Length = 881 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -1 Query: 219 KIEKEIERRNSDPKLRNRCGAGVLPYELLTPSSESGVTCRGVPNSVSI 76 +IEKEIE+RN DP L+NRCGAGVLPYELL PSSE GVTCRGVPNSVSI Sbjct: 834 RIEKEIEKRNQDPSLKNRCGAGVLPYELLAPSSEPGVTCRGVPNSVSI 881 >gb|AAF97315.1|AC007843_18 lipoxygenase [Arabidopsis thaliana] Length = 912 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -1 Query: 219 KIEKEIERRNSDPKLRNRCGAGVLPYELLTPSSESGVTCRGVPNSVSI 76 +IEKEIE+RN+DP RNRCGAGVLPYELL PSSE GVTCRGVPNSVSI Sbjct: 865 RIEKEIEKRNADPDRRNRCGAGVLPYELLVPSSEPGVTCRGVPNSVSI 912 >ref|NP_564021.1| lipoxygenase 3 [Arabidopsis thaliana] gi|75264086|sp|Q9LNR3.1|LOX3_ARATH RecName: Full=Lipoxygenase 3, chloroplastic; Short=AtLOX3; Flags: Precursor gi|8778453|gb|AAF79461.1|AC022492_5 F1L3.11 [Arabidopsis thaliana] gi|19715630|gb|AAL91636.1| At1g17420/F1L3_1 [Arabidopsis thaliana] gi|30102476|gb|AAP21156.1| At1g17420/F1L3_1 [Arabidopsis thaliana] gi|332191464|gb|AEE29585.1| lipoxygenase 3 [Arabidopsis thaliana] Length = 919 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -1 Query: 219 KIEKEIERRNSDPKLRNRCGAGVLPYELLTPSSESGVTCRGVPNSVSI 76 +IEKEIE+RN+DP RNRCGAGVLPYELL PSSE GVTCRGVPNSVSI Sbjct: 872 RIEKEIEKRNADPDRRNRCGAGVLPYELLVPSSEPGVTCRGVPNSVSI 919 >ref|XP_002890224.1| hypothetical protein ARALYDRAFT_471947 [Arabidopsis lyrata subsp. lyrata] gi|297336066|gb|EFH66483.1| hypothetical protein ARALYDRAFT_471947 [Arabidopsis lyrata subsp. lyrata] Length = 919 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -1 Query: 219 KIEKEIERRNSDPKLRNRCGAGVLPYELLTPSSESGVTCRGVPNSVSI 76 +IEKEIE+RN+DP RNRCGAGVLPYELL PSSE GVTCRGVPNSVSI Sbjct: 872 RIEKEIEKRNADPDRRNRCGAGVLPYELLVPSSEPGVTCRGVPNSVSI 919