BLASTX nr result
ID: Coptis21_contig00014724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014724 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-10 emb|CAN63706.1| hypothetical protein VITISV_013107 [Vitis vinifera] 68 9e-10 ref|XP_002309173.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_003623530.1| Pentatricopeptide repeat-containing protein ... 58 9e-07 >ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] gi|449483740|ref|XP_004156675.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] Length = 491 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/74 (47%), Positives = 50/74 (67%), Gaps = 1/74 (1%) Frame = -1 Query: 221 TLLNNTGNLLRKRRKWGQSLTPYKGKWQETFNQQQAMEALKKAANNDEKP-LVSVLVNSF 45 +++ + N LRK RKW L+ +K KW +TF+Q +A+ LK+AAN D+ L+S LV SF Sbjct: 6 SVVKKSNNFLRKHRKW--PLSSHKTKWHQTFDQDEALRILKQAANPDQPHLLLSALVTSF 63 Query: 44 EMYACEPTPSAYSF 3 Y+C PTP+AY F Sbjct: 64 TAYSCHPTPNAYYF 77 >ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Vitis vinifera] Length = 505 Score = 67.8 bits (164), Expect = 9e-10 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 8/74 (10%) Frame = -1 Query: 200 NLLRKRRKWGQSLTPYKGKWQETFNQQQAMEALKKA-ANNDEKP-------LVSVLVNSF 45 N LRKRRKW L+PYK W ETF+ +QAM+ LK AN P +S+L++SF Sbjct: 11 NFLRKRRKW--PLSPYKATWHETFHHRQAMQTLKNTIANQSPSPQSPSNSQFLSILIDSF 68 Query: 44 EMYACEPTPSAYSF 3 +Y +PTP+AY F Sbjct: 69 RIYNSDPTPNAYRF 82 >emb|CAN63706.1| hypothetical protein VITISV_013107 [Vitis vinifera] Length = 390 Score = 67.8 bits (164), Expect = 9e-10 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 8/74 (10%) Frame = -1 Query: 200 NLLRKRRKWGQSLTPYKGKWQETFNQQQAMEALKKA-ANNDEKP-------LVSVLVNSF 45 N LRKRRKW L+PYK W ETF+ +QAM+ LK AN P +S+L++SF Sbjct: 13 NFLRKRRKW--PLSPYKATWHETFHHRQAMQTLKNTIANQSPSPQSPSNSQFLSILIDSF 70 Query: 44 EMYACEPTPSAYSF 3 +Y +PTP+AY F Sbjct: 71 RIYNSDPTPNAYRF 84 >ref|XP_002309173.1| predicted protein [Populus trichocarpa] gi|222855149|gb|EEE92696.1| predicted protein [Populus trichocarpa] Length = 506 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/71 (47%), Positives = 45/71 (63%), Gaps = 7/71 (9%) Frame = -1 Query: 194 LRKRRKWGQSLTPYKGKWQETFNQQQAMEALKKAA------NNDEKP-LVSVLVNSFEMY 36 LRK RKW S PYK +W FNQQQAM++LK++A + KP L+S L++SF +Y Sbjct: 14 LRKHRKWPYS--PYKARWHRIFNQQQAMQSLKQSALKPPQQESPNKPHLLSSLIHSFSIY 71 Query: 35 ACEPTPSAYSF 3 EP P A+ F Sbjct: 72 DVEPAPKAFDF 82 >ref|XP_003623530.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498545|gb|AES79748.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 653 Score = 57.8 bits (138), Expect = 9e-07 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 5/76 (6%) Frame = -1 Query: 215 LNNTGN-LLRKRRKWGQSLTPYKGKWQETFNQQQAMEALKKAA----NNDEKPLVSVLVN 51 L+ T N LRK RKW S PYK W F +QQA++ L A NN++ L+S L++ Sbjct: 6 LSKTANKYLRKFRKWPHS--PYKTSWHHNFGEQQAIQILINAKTQTQNNNDPFLLSTLIH 63 Query: 50 SFEMYACEPTPSAYSF 3 SF+ Y +P+P AY F Sbjct: 64 SFKAYHTDPSPKAYFF 79