BLASTX nr result
ID: Coptis21_contig00014345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014345 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319269.1| histone 2 [Populus trichocarpa] gi|222857645... 56 3e-06 >ref|XP_002319269.1| histone 2 [Populus trichocarpa] gi|222857645|gb|EEE95192.1| histone 2 [Populus trichocarpa] Length = 169 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/33 (87%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 162 EKSQQMAGRGKTLGSGA-KKATSRSSKAGLQFP 257 +K+Q MAGRGKTLGSGA KKATSRSSKAGLQFP Sbjct: 31 DKNQSMAGRGKTLGSGASKKATSRSSKAGLQFP 63