BLASTX nr result
ID: Coptis21_contig00014286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014286 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520394.1| protein with unknown function [Ricinus commu... 57 2e-06 >ref|XP_002520394.1| protein with unknown function [Ricinus communis] gi|223540441|gb|EEF42010.1| protein with unknown function [Ricinus communis] Length = 275 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = +1 Query: 115 LMDEIEGLKQNETEHEQDKKALEAISTRASQLEIEVSRLQHDFISTVS 258 L EIE L+ E++ E KKAL+A++ RASQLE EVSRLQHD IS +S Sbjct: 55 LTAEIELLRSKESDAEAQKKALDAVAARASQLETEVSRLQHDLISAMS 102