BLASTX nr result
ID: Coptis21_contig00014089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014089 (515 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532283.1| Rho GDP-dissociation inhibitor, putative [Ri... 105 5e-21 ref|XP_002520560.1| Rho GDP-dissociation inhibitor, putative [Ri... 104 7e-21 ref|XP_003518574.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 103 1e-20 ref|XP_003545071.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 103 1e-20 ref|NP_187445.1| Rho GDP-dissociation inhibitor 1 [Arabidopsis t... 102 4e-20 >ref|XP_002532283.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] gi|223528017|gb|EEF30098.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] Length = 246 Score = 105 bits (261), Expect = 5e-21 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = +1 Query: 1 PYTHVMPEETTPSGIFARGSYSARTKFIDDDNKCYLEINYTFDIRKEWASS 153 PYTHVMPEETTPSG+FARGSYSA++KF+DDDNKCYLEINYTFDIRKEWA++ Sbjct: 196 PYTHVMPEETTPSGMFARGSYSAKSKFLDDDNKCYLEINYTFDIRKEWAAT 246 >ref|XP_002520560.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] gi|223540220|gb|EEF41793.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] Length = 243 Score = 104 bits (260), Expect = 7e-21 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 1 PYTHVMPEETTPSGIFARGSYSARTKFIDDDNKCYLEINYTFDIRKEWASS 153 PYTH MPEETTPSGIFARGSYSAR+KF+DDDNKCYLEINYTFDIRKEW S+ Sbjct: 193 PYTHEMPEETTPSGIFARGSYSARSKFVDDDNKCYLEINYTFDIRKEWQST 243 >ref|XP_003518574.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Glycine max] Length = 233 Score = 103 bits (257), Expect = 1e-20 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = +1 Query: 1 PYTHVMPEETTPSGIFARGSYSARTKFIDDDNKCYLEINYTFDIRKEWA 147 PYTH MPEETTPSG+FARGSYSAR+KF+DDDNKCYLEINYTFDIRKEWA Sbjct: 185 PYTHEMPEETTPSGLFARGSYSARSKFLDDDNKCYLEINYTFDIRKEWA 233 >ref|XP_003545071.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Glycine max] Length = 227 Score = 103 bits (257), Expect = 1e-20 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = +1 Query: 1 PYTHVMPEETTPSGIFARGSYSARTKFIDDDNKCYLEINYTFDIRKEWA 147 PYTH MPEETTPSG+FARGSYSAR+KF+DDDNKCYLEINYTFDIRKEWA Sbjct: 179 PYTHEMPEETTPSGLFARGSYSARSKFLDDDNKCYLEINYTFDIRKEWA 227 >ref|NP_187445.1| Rho GDP-dissociation inhibitor 1 [Arabidopsis thaliana] gi|21759146|sp|Q9SFC6.1|GDIR_ARATH RecName: Full=Rho GDP-dissociation inhibitor 1; Short=AtRhoGDI1; Short=Rho GDI-1 gi|6648200|gb|AAF21198.1|AC013483_22 putative RHO GDP-dissociation inhibitor 1 [Arabidopsis thaliana] gi|15866274|gb|AAL10299.1|AF412276_1 Rho GDP-dissociation inhibitor 1 [Arabidopsis thaliana] gi|21553639|gb|AAM62732.1| putative RHO GDP-dissociation inhibitor 1 [Arabidopsis thaliana] gi|26451537|dbj|BAC42866.1| putative RHO GDP-dissociation inhibitor 1 [Arabidopsis thaliana] gi|28973347|gb|AAO63998.1| putative RHO GDP-dissociation inhibitor 1 [Arabidopsis thaliana] gi|332641093|gb|AEE74614.1| Rho GDP-dissociation inhibitor 1 [Arabidopsis thaliana] Length = 240 Score = 102 bits (253), Expect = 4e-20 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 1 PYTHVMPEETTPSGIFARGSYSARTKFIDDDNKCYLEINYTFDIRKEW 144 PY HVMPEETTPSG+FARGSYSARTKF+DDDNKCYLEINY+FDIRKEW Sbjct: 190 PYNHVMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFDIRKEW 237