BLASTX nr result
ID: Coptis21_contig00013439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00013439 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220... 59 4e-07 >ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220238, partial [Cucumis sativus] Length = 169 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/70 (37%), Positives = 38/70 (54%) Frame = -2 Query: 225 GTPKFMDDATAKRKRLTCARFCIEFPVNHEYKDTIKIKVGDREIDIPLEYPWKPQSCERC 46 G P +D AT +R RL+ AR C+E V+ I + + E +P+ Y WKP+ C C Sbjct: 78 GKPLSVDLATKERCRLSYARICVELNVDSTMPIEITVNLRGEEFIVPVTYEWKPRKCNLC 137 Query: 45 NRFGHTTQQC 16 + FGH+ C Sbjct: 138 HSFGHSQSTC 147