BLASTX nr result
ID: Coptis21_contig00013252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00013252 (1721 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522771.1| conserved hypothetical protein [Ricinus comm... 68 7e-11 ref|XP_002266069.1| PREDICTED: poly(A)-specific ribonuclease PAR... 71 5e-10 emb|CAN76999.1| hypothetical protein VITISV_007764 [Vitis vinifera] 71 5e-10 emb|CBI39748.3| unnamed protein product [Vitis vinifera] 71 5e-10 ref|XP_004148252.1| PREDICTED: poly(A)-specific ribonuclease PAR... 62 5e-09 >ref|XP_002522771.1| conserved hypothetical protein [Ricinus communis] gi|223538009|gb|EEF39622.1| conserved hypothetical protein [Ricinus communis] Length = 699 Score = 67.8 bits (164), Expect(2) = 7e-11 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 207 LMQQEVKDSKRKEAEMKLKVAVGFCHVIDLLCSEQKLVVGHNCFL 73 L+ +EVKD RK AEMK+K A+GF HVIDLL S QKL+VGHNCFL Sbjct: 282 LLMKEVKDEYRKGAEMKIKNAIGFRHVIDLLSSAQKLIVGHNCFL 326 Score = 26.9 bits (58), Expect(2) = 7e-11 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 70 FLALFLSTIEEFVSFVNEHFPSI 2 FL T EEFVS VN++FP I Sbjct: 335 FLGPLPPTAEEFVSAVNKYFPHI 357 >ref|XP_002266069.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Vitis vinifera] Length = 734 Score = 70.9 bits (172), Expect(2) = 5e-10 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -3 Query: 207 LMQQEVKDSKRKEAEMKLKVAVGFCHVIDLLCSEQKLVVGHNCFL 73 L+ +EVKD R+EAEMK+K AVGF HVIDLL SEQKL+VGHNC L Sbjct: 313 LLMKEVKDGLRREAEMKIKTAVGFRHVIDLLSSEQKLIVGHNCLL 357 Score = 21.2 bits (43), Expect(2) = 5e-10 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -2 Query: 49 TIEEFVSFVNEHFP 8 T E+FVS ++++FP Sbjct: 373 TAEDFVSSIHKYFP 386 >emb|CAN76999.1| hypothetical protein VITISV_007764 [Vitis vinifera] Length = 720 Score = 70.9 bits (172), Expect(2) = 5e-10 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -3 Query: 207 LMQQEVKDSKRKEAEMKLKVAVGFCHVIDLLCSEQKLVVGHNCFL 73 L+ +EVKD R+EAEMK+K AVGF HVIDLL SEQKL+VGHNC L Sbjct: 313 LLMKEVKDGLRREAEMKIKTAVGFRHVIDLLSSEQKLIVGHNCLL 357 Score = 21.2 bits (43), Expect(2) = 5e-10 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -2 Query: 49 TIEEFVSFVNEHFP 8 T E+FVS ++++FP Sbjct: 373 TAEDFVSSIHKYFP 386 >emb|CBI39748.3| unnamed protein product [Vitis vinifera] Length = 715 Score = 70.9 bits (172), Expect(2) = 5e-10 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -3 Query: 207 LMQQEVKDSKRKEAEMKLKVAVGFCHVIDLLCSEQKLVVGHNCFL 73 L+ +EVKD R+EAEMK+K AVGF HVIDLL SEQKL+VGHNC L Sbjct: 313 LLMKEVKDGLRREAEMKIKTAVGFRHVIDLLSSEQKLIVGHNCLL 357 Score = 21.2 bits (43), Expect(2) = 5e-10 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -2 Query: 49 TIEEFVSFVNEHFP 8 T E+FVS ++++FP Sbjct: 373 TAEDFVSSIHKYFP 386 >ref|XP_004148252.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis sativus] gi|449524565|ref|XP_004169292.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis sativus] Length = 700 Score = 61.6 bits (148), Expect(2) = 5e-09 Identities = 34/72 (47%), Positives = 48/72 (66%), Gaps = 10/72 (13%) Frame = -3 Query: 258 LCFLRLING-VDLYLMLV---------LMQQEVKDSKRKEAEMKLKVAVGFCHVIDLLCS 109 LCF+ + +G DL ++V L+ QEV +++ EMK++ A+GF HVIDLL S Sbjct: 288 LCFVVVNDGNADLQQLVVFVDSRDDKELLMQEVNRDQKEVNEMKIQSAIGFRHVIDLLSS 347 Query: 108 EQKLVVGHNCFL 73 E+KL+VGHNCFL Sbjct: 348 EKKLIVGHNCFL 359 Score = 26.9 bits (58), Expect(2) = 5e-09 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 70 FLALFLSTIEEFVSFVNEHFPSI 2 F+ ST EEFVS + +HFP I Sbjct: 368 FIGSLPSTTEEFVSSLGKHFPYI 390