BLASTX nr result
ID: Coptis21_contig00013058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00013058 (728 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314999.1| predicted protein [Populus trichocarpa] gi|2... 60 5e-07 ref|XP_002285502.1| PREDICTED: ubiquinone biosynthesis protein C... 60 6e-07 ref|NP_001149451.1| ubiquinone biosynthesis protein COQ4 [Zea ma... 57 3e-06 ref|XP_002447311.1| hypothetical protein SORBIDRAFT_06g032660 [S... 56 7e-06 ref|XP_003580809.1| PREDICTED: ubiquinone biosynthesis protein C... 56 9e-06 >ref|XP_002314999.1| predicted protein [Populus trichocarpa] gi|222864039|gb|EEF01170.1| predicted protein [Populus trichocarpa] Length = 229 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 2 LISVYYERHFHEDLEDMRRRWGIVPAPAPPKPD 100 L+ VYYE+HFHEDLED+RR+WGI PAPA P D Sbjct: 195 LMCVYYEKHFHEDLEDVRRKWGITPAPAAPNQD 227 >ref|XP_002285502.1| PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Vitis vinifera] Length = 227 Score = 59.7 bits (143), Expect = 6e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +2 Query: 2 LISVYYERHFHEDLEDMRRRWGIVPAPAPPK 94 L+ +YYE+HFHEDL+D+RR+WGIVPAP PP+ Sbjct: 196 LMCIYYEQHFHEDLDDVRRKWGIVPAPPPPR 226 >ref|NP_001149451.1| ubiquinone biosynthesis protein COQ4 [Zea mays] gi|195627326|gb|ACG35493.1| ubiquinone biosynthesis protein COQ4 [Zea mays] Length = 227 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 2 LISVYYERHFHEDLEDMRRRWGIVPAPAPPK 94 L+SVYYE+HFHEDLE++RR WGI+P P+P K Sbjct: 194 LMSVYYEKHFHEDLEEVRRNWGILPCPSPKK 224 >ref|XP_002447311.1| hypothetical protein SORBIDRAFT_06g032660 [Sorghum bicolor] gi|241938494|gb|EES11639.1| hypothetical protein SORBIDRAFT_06g032660 [Sorghum bicolor] Length = 175 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 2 LISVYYERHFHEDLEDMRRRWGIVPAPAPPK 94 L+SVYYE+HFHEDLE++RR WGI+P P P K Sbjct: 142 LMSVYYEKHFHEDLEEVRRNWGILPCPNPQK 172 >ref|XP_003580809.1| PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial-like [Brachypodium distachyon] Length = 227 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 2 LISVYYERHFHEDLEDMRRRWGIVPAPAP 88 L+SVYYE+HFHEDLE++RR WGIVP P P Sbjct: 194 LMSVYYEKHFHEDLEEVRRNWGIVPCPDP 222