BLASTX nr result
ID: Coptis21_contig00012269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00012269 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB88648.1| microtubule bundling polypeptide TMBP200 [Nicoti... 60 2e-07 ref|XP_002534264.1| microtubule associated protein xmap215, puta... 60 2e-07 ref|XP_002271272.2| PREDICTED: protein MOR1-like, partial [Vitis... 59 5e-07 emb|CBI29531.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002300496.1| microtubule organization protein [Populus tr... 58 7e-07 >dbj|BAB88648.1| microtubule bundling polypeptide TMBP200 [Nicotiana tabacum] Length = 2029 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/41 (78%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +3 Query: 3 QNASEAFRTYIRDGLAQMEKNAAAGSISSSVDFS--PPTAL 119 QNASEAFRTYIRDGLAQMEKNAAAG SSV S PP++L Sbjct: 1825 QNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPSSL 1865 >ref|XP_002534264.1| microtubule associated protein xmap215, putative [Ricinus communis] gi|223525620|gb|EEF28119.1| microtubule associated protein xmap215, putative [Ricinus communis] Length = 1992 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/41 (78%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +3 Query: 3 QNASEAFRTYIRDGLAQMEKNAAAGSISSSVDFS--PPTAL 119 QNASEAFRTYIRDGLAQMEKNAAAG SS+ S PP+AL Sbjct: 1791 QNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPSAL 1831 >ref|XP_002271272.2| PREDICTED: protein MOR1-like, partial [Vitis vinifera] Length = 1007 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +3 Query: 3 QNASEAFRTYIRDGLAQMEKNAAAGSISSSVDFS--PPTAL 119 QNASEAFRTYIRDGLAQMEKNAAAG SS+ S PP++L Sbjct: 801 QNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPSSL 841 >emb|CBI29531.3| unnamed protein product [Vitis vinifera] Length = 991 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +3 Query: 3 QNASEAFRTYIRDGLAQMEKNAAAGSISSSVDFS--PPTAL 119 QNASEAFRTYIRDGLAQMEKNAAAG SS+ S PP++L Sbjct: 785 QNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPSSL 825 >ref|XP_002300496.1| microtubule organization protein [Populus trichocarpa] gi|222847754|gb|EEE85301.1| microtubule organization protein [Populus trichocarpa] Length = 2036 Score = 58.2 bits (139), Expect = 7e-07 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +3 Query: 3 QNASEAFRTYIRDGLAQMEKNAAAGSISSSVDFS--PPTAL 119 QNASEAFRTYIRDGLAQMEKN AAG SS+ S PP+AL Sbjct: 1835 QNASEAFRTYIRDGLAQMEKNTAAGRTPSSLPISTPPPSAL 1875