BLASTX nr result
ID: Coptis21_contig00011480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00011480 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281957.1| PREDICTED: G-protein coupled receptor 1 [Vit... 70 2e-10 gb|AGC31663.1| putative G-protein-coupled receptor [Malus x dome... 66 3e-09 ref|XP_004141349.1| PREDICTED: G-protein coupled receptor 1-like... 65 6e-09 ref|XP_003550219.1| PREDICTED: G-protein coupled receptor 1-like... 64 1e-08 ref|XP_003544584.1| PREDICTED: G-protein coupled receptor 1-like... 64 1e-08 >ref|XP_002281957.1| PREDICTED: G-protein coupled receptor 1 [Vitis vinifera] gi|296081730|emb|CBI20735.3| unnamed protein product [Vitis vinifera] Length = 319 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -3 Query: 484 FHLYVWGTSLV-TVIRSIGNDPGRVGVWCWSETGRTGKV 371 FHLYVWGTSLV TVIRSIGND G +GVWCW + G+TGKV Sbjct: 122 FHLYVWGTSLVMTVIRSIGNDHGHLGVWCWEQRGQTGKV 160 >gb|AGC31663.1| putative G-protein-coupled receptor [Malus x domestica] Length = 319 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/38 (73%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -3 Query: 484 FHLYVWGTSLV-TVIRSIGNDPGRVGVWCWSETGRTGK 374 FHLYVWGTSLV TV+RSIGN+ +G WCWS++GRTGK Sbjct: 123 FHLYVWGTSLVVTVVRSIGNNHSHLGTWCWSQSGRTGK 160 >ref|XP_004141349.1| PREDICTED: G-protein coupled receptor 1-like [Cucumis sativus] gi|449486726|ref|XP_004157382.1| PREDICTED: G-protein coupled receptor 1-like [Cucumis sativus] Length = 318 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/38 (73%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -3 Query: 484 FHLYVWGTSLV-TVIRSIGNDPGRVGVWCWSETGRTGK 374 FHLYVWGTSLV TVIRSIGN+ G +G WCW+++ RTGK Sbjct: 122 FHLYVWGTSLVLTVIRSIGNNHGHLGTWCWAQSSRTGK 159 >ref|XP_003550219.1| PREDICTED: G-protein coupled receptor 1-like [Glycine max] Length = 318 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 484 FHLYVWGTSLV-TVIRSIGNDPGRVGVWCWSETGRTGK 374 FHLYVWGTSLV TV+RS GND G WCW++TGRTGK Sbjct: 123 FHLYVWGTSLVMTVMRSFGNDHKHFGAWCWTQTGRTGK 160 >ref|XP_003544584.1| PREDICTED: G-protein coupled receptor 1-like [Glycine max] Length = 318 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 484 FHLYVWGTSLV-TVIRSIGNDPGRVGVWCWSETGRTGK 374 FHLYVWGTSLV TV+RS GND G WCW++TGRTGK Sbjct: 123 FHLYVWGTSLVMTVMRSFGNDHKHFGAWCWTQTGRTGK 160