BLASTX nr result
ID: Coptis21_contig00011465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00011465 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003560419.1| PREDICTED: F-box protein At5g07610-like [Bra... 54 1e-05 ref|XP_002442909.1| hypothetical protein SORBIDRAFT_08g004750 [S... 54 1e-05 >ref|XP_003560419.1| PREDICTED: F-box protein At5g07610-like [Brachypodium distachyon] Length = 497 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 313 RLKKRTRSSFRRDIPDDLLPEILKRLPLKSLCRFKCVSKSWRSTI 447 R+KK SS D+ DDL+ EIL RLP KS+CRFKCVS WRS I Sbjct: 3 RVKKT--SSPAADLTDDLIVEILSRLPAKSICRFKCVSPHWRSLI 45 >ref|XP_002442909.1| hypothetical protein SORBIDRAFT_08g004750 [Sorghum bicolor] gi|241943602|gb|EES16747.1| hypothetical protein SORBIDRAFT_08g004750 [Sorghum bicolor] Length = 311 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 352 IPDDLLPEILKRLPLKSLCRFKCVSKSWRSTI 447 +PD+L+ EIL RLP KSLCRFKCVS++WRS I Sbjct: 16 LPDELIVEILARLPAKSLCRFKCVSRAWRSLI 47