BLASTX nr result
ID: Coptis21_contig00011124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00011124 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265307.1| PREDICTED: histidine-containing phosphotrans... 66 3e-09 ref|XP_002512314.1| Histidine-containing phosphotransfer protein... 65 7e-09 ref|NP_001237176.1| uncharacterized protein LOC100306589 [Glycin... 64 1e-08 ref|XP_002272153.2| PREDICTED: histidine-containing phosphotrans... 64 1e-08 ref|XP_002319035.1| histidine phosphotransfer protein [Populus t... 64 2e-08 >ref|XP_002265307.1| PREDICTED: histidine-containing phosphotransfer protein 1 [Vitis vinifera] gi|298205016|emb|CBI34323.3| unnamed protein product [Vitis vinifera] Length = 150 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 CLRCLQQVRHEYTFVKNKLETLFGLQQQILAAGGSIPI 116 CL+CLQQV++EY VKNKLETLF L+QQILAAGGSIP+ Sbjct: 113 CLKCLQQVKNEYALVKNKLETLFQLEQQILAAGGSIPM 150 >ref|XP_002512314.1| Histidine-containing phosphotransfer protein, putative [Ricinus communis] gi|223548275|gb|EEF49766.1| Histidine-containing phosphotransfer protein, putative [Ricinus communis] Length = 152 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = +3 Query: 3 CLRCLQQVRHEYTFVKNKLETLFGLQQQILAAGGSIPI 116 CL+CLQQV+HEY+ +K KLETLF L++Q+LAAGGSIP+ Sbjct: 113 CLKCLQQVKHEYSLIKTKLETLFKLERQVLAAGGSIPL 150 >ref|NP_001237176.1| uncharacterized protein LOC100306589 [Glycine max] gi|255628993|gb|ACU14841.1| unknown [Glycine max] Length = 155 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 3 CLRCLQQVRHEYTFVKNKLETLFGLQQQILAAGGSIP 113 CLRCLQQV+ EY VKNKLET+F L+QQI+AAGGSIP Sbjct: 112 CLRCLQQVKQEYCIVKNKLETMFRLEQQIVAAGGSIP 148 >ref|XP_002272153.2| PREDICTED: histidine-containing phosphotransfer protein 5-like [Vitis vinifera] gi|296086667|emb|CBI32302.3| unnamed protein product [Vitis vinifera] Length = 151 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +3 Query: 3 CLRCLQQVRHEYTFVKNKLETLFGLQQQILAAGGSIPI 116 C RCLQQ+RHEY+ +K+KLETLF L+QQI+AAGGSIP+ Sbjct: 112 CKRCLQQLRHEYSLLKSKLETLFRLEQQIIAAGGSIPM 149 >ref|XP_002319035.1| histidine phosphotransfer protein [Populus trichocarpa] gi|222857411|gb|EEE94958.1| histidine phosphotransfer protein [Populus trichocarpa] Length = 152 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 3 CLRCLQQVRHEYTFVKNKLETLFGLQQQILAAGGSIP 113 C +CLQQVRHEY+ VK KLETLF L+Q+ILAAGGSIP Sbjct: 113 CQKCLQQVRHEYSLVKTKLETLFKLEQKILAAGGSIP 149