BLASTX nr result
ID: Coptis21_contig00011070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00011070 (608 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322104.1| auxin efflux carrier component [Populus tric... 54 8e-06 gb|AAG17172.1|AF190881_1 PIN1-like auxin transport protein [Popu... 54 8e-06 dbj|BAH47608.1| auxin:hydrogen symporter/transporter [Zinnia vio... 54 1e-05 >ref|XP_002322104.1| auxin efflux carrier component [Populus trichocarpa] gi|222869100|gb|EEF06231.1| auxin efflux carrier component [Populus trichocarpa] Length = 614 Score = 53.9 bits (128), Expect(2) = 8e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 511 LLWAALPQGIVPFVFAKEYNVHPKIVSAG*RFTYLI 404 ++ AALPQGIVPFVFAKEYNVHP+I+S G F LI Sbjct: 565 IVQAALPQGIVPFVFAKEYNVHPEILSTGVIFGMLI 600 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 335 ISFGMLITVPIT 300 + FGMLI +PIT Sbjct: 594 VIFGMLIALPIT 605 >gb|AAG17172.1|AF190881_1 PIN1-like auxin transport protein [Populus tremula x Populus tremuloides] Length = 614 Score = 53.9 bits (128), Expect(2) = 8e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 511 LLWAALPQGIVPFVFAKEYNVHPKIVSAG*RFTYLI 404 ++ AALPQGIVPFVFAKEYNVHP+I+S G F LI Sbjct: 565 IVQAALPQGIVPFVFAKEYNVHPEILSTGVIFGMLI 600 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 335 ISFGMLITVPIT 300 + FGMLI +PIT Sbjct: 594 VIFGMLIALPIT 605 >dbj|BAH47608.1| auxin:hydrogen symporter/transporter [Zinnia violacea] Length = 590 Score = 53.5 bits (127), Expect(2) = 1e-05 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 511 LLWAALPQGIVPFVFAKEYNVHPKIVSAG*RFTYLI 404 ++ AALPQGIVPFVFAKEYNVHP I+S G F LI Sbjct: 539 IVQAALPQGIVPFVFAKEYNVHPNILSTGVIFGMLI 574 Score = 21.2 bits (43), Expect(2) = 1e-05 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 335 ISFGMLITVPIT 300 + FGMLI +PIT Sbjct: 568 VIFGMLIALPIT 579