BLASTX nr result
ID: Coptis21_contig00010953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00010953 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC98494.1| AG-motif binding protein-4 [Nicotiana tabacum] 55 8e-06 >dbj|BAC98494.1| AG-motif binding protein-4 [Nicotiana tabacum] Length = 326 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/58 (48%), Positives = 40/58 (68%) Frame = +1 Query: 166 MDCVETKALKTSFWPEMSALKTTTTTQQIFNEDLWCGNGTNGVAGDDLFVEGLLDFSN 339 M+ +E +ALK+SF +M A+KT+ QQ+F +D+WC G N V DD V+ LLDFS+ Sbjct: 1 MELIEARALKSSFLSDM-AMKTS---QQVFLDDIWCVAGINNVPSDDFSVDDLLDFSD 54