BLASTX nr result
ID: Coptis21_contig00010682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00010682 (567 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS21013.1| chorismate mutase [Hyacinthus orientalis] 57 3e-06 ref|XP_002324083.1| chorismate mutase [Populus trichocarpa] gi|2... 55 6e-06 gb|AAD21624.1| chorismate mutase 3 [Arabidopsis thaliana] 55 8e-06 ref|NP_177096.1| chorismate mutase 3 [Arabidopsis thaliana] gi|1... 55 8e-06 gb|AFW84986.1| hypothetical protein ZEAMMB73_157098 [Zea mays] 55 8e-06 >gb|AAS21013.1| chorismate mutase [Hyacinthus orientalis] Length = 289 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -2 Query: 566 FSNLLPRLVKEGNDGNCGSTALCDTTCLQ 480 FS LLPRLVKEG+DGNCGS+A+CDT CLQ Sbjct: 123 FSKLLPRLVKEGDDGNCGSSAVCDTICLQ 151 >ref|XP_002324083.1| chorismate mutase [Populus trichocarpa] gi|222867085|gb|EEF04216.1| chorismate mutase [Populus trichocarpa] Length = 374 Score = 55.5 bits (132), Expect = 6e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 566 FSNLLPRLVKEGNDGNCGSTALCDTTCLQ 480 F L+PRLVKEG+DGNCGSTA+CDT CLQ Sbjct: 185 FRELIPRLVKEGDDGNCGSTAVCDTICLQ 213 >gb|AAD21624.1| chorismate mutase 3 [Arabidopsis thaliana] Length = 316 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 566 FSNLLPRLVKEGNDGNCGSTALCDTTCLQV 477 F +LLPRLVK G+DGNCGS ALCDT CLQ+ Sbjct: 179 FKHLLPRLVKPGDDGNCGSAALCDTMCLQI 208 >ref|NP_177096.1| chorismate mutase 3 [Arabidopsis thaliana] gi|12325088|gb|AAG52497.1|AC018364_15 putative chorismate mutase; 16810-15349 [Arabidopsis thaliana] gi|12597791|gb|AAG60103.1|AC073178_14 chorismate mutase, putative [Arabidopsis thaliana] gi|26450785|dbj|BAC42501.1| putative chorismate mutase [Arabidopsis thaliana] gi|28950893|gb|AAO63370.1| At1g69370 [Arabidopsis thaliana] gi|332196795|gb|AEE34916.1| chorismate mutase 3 [Arabidopsis thaliana] Length = 316 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 566 FSNLLPRLVKEGNDGNCGSTALCDTTCLQV 477 F +LLPRLVK G+DGNCGS ALCDT CLQ+ Sbjct: 179 FKHLLPRLVKPGDDGNCGSAALCDTMCLQI 208 >gb|AFW84986.1| hypothetical protein ZEAMMB73_157098 [Zea mays] Length = 241 Score = 55.1 bits (131), Expect = 8e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 566 FSNLLPRLVKEGNDGNCGSTALCDTTCLQ 480 F LLPRLVKEG+DGN GS+ALCDTTCLQ Sbjct: 175 FDELLPRLVKEGSDGNAGSSALCDTTCLQ 203