BLASTX nr result
ID: Coptis21_contig00009994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00009994 (540 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004141535.1| PREDICTED: ribosomal RNA processing protein ... 63 3e-08 ref|XP_002282782.1| PREDICTED: ribosomal RNA processing protein ... 63 3e-08 ref|XP_002509710.1| conserved hypothetical protein [Ricinus comm... 62 7e-08 ref|XP_002299562.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_003521510.1| PREDICTED: ribosomal RNA processing protein ... 60 3e-07 >ref|XP_004141535.1| PREDICTED: ribosomal RNA processing protein 36 homolog [Cucumis sativus] gi|449481495|ref|XP_004156200.1| PREDICTED: ribosomal RNA processing protein 36 homolog [Cucumis sativus] Length = 253 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 111 IRDPRFESLCGNLDTDWFKRRYSFIYEAELPAEKEEL 1 +RDPRFESL G LD D FK+RYSFIYE LPAEKEEL Sbjct: 103 VRDPRFESLSGTLDADGFKKRYSFIYEKTLPAEKEEL 139 >ref|XP_002282782.1| PREDICTED: ribosomal RNA processing protein 36 homolog [Vitis vinifera] gi|297742597|emb|CBI34746.3| unnamed protein product [Vitis vinifera] Length = 236 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 111 IRDPRFESLCGNLDTDWFKRRYSFIYEAELPAEKEEL 1 +RDPRFESLCG LD D F++RY+F+YE ELPAE+E L Sbjct: 89 VRDPRFESLCGTLDADGFRKRYNFLYETELPAEREGL 125 >ref|XP_002509710.1| conserved hypothetical protein [Ricinus communis] gi|223549609|gb|EEF51097.1| conserved hypothetical protein [Ricinus communis] Length = 252 Score = 61.6 bits (148), Expect = 7e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 111 IRDPRFESLCGNLDTDWFKRRYSFIYEAELPAEKEE 4 +RDPRFESLCG LD D F++RY+F+YE LPAE+EE Sbjct: 105 VRDPRFESLCGQLDVDGFRKRYNFLYEENLPAEREE 140 >ref|XP_002299562.1| predicted protein [Populus trichocarpa] gi|222846820|gb|EEE84367.1| predicted protein [Populus trichocarpa] Length = 247 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 111 IRDPRFESLCGNLDTDWFKRRYSFIYEAELPAEKEEL 1 +RDPRFESLCGNLD + F++RY F+++ LPAEKEEL Sbjct: 97 VRDPRFESLCGNLDVEGFRKRYDFLFKNNLPAEKEEL 133 >ref|XP_003521510.1| PREDICTED: ribosomal RNA processing protein 36 homolog [Glycine max] Length = 250 Score = 59.7 bits (143), Expect = 3e-07 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 111 IRDPRFESLCGNLDTDWFKRRYSFIYEAELPAEKEEL 1 +RDPRFESLCG LD D F++RY+F+YE +LPAE++ L Sbjct: 103 VRDPRFESLCGKLDPDGFRKRYNFLYENDLPAERQAL 139