BLASTX nr result
ID: Coptis21_contig00009621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00009621 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282506.1| PREDICTED: ubiquitin-associated domain-conta... 64 1e-08 ref|NP_191233.1| Ubiquitin-associated (UBA) protein [Arabidopsis... 60 1e-07 ref|XP_002876380.1| ubiquitin-associated /TS-N domain-containing... 59 3e-07 ref|XP_003554120.1| PREDICTED: uncharacterized protein LOC100805... 58 7e-07 ref|XP_003624969.1| Ubiquitin-associated domain-containing prote... 56 3e-06 >ref|XP_002282506.1| PREDICTED: ubiquitin-associated domain-containing protein 2 isoform 1 [Vitis vinifera] gi|297741648|emb|CBI32780.3| unnamed protein product [Vitis vinifera] Length = 294 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/66 (48%), Positives = 46/66 (69%) Frame = -2 Query: 199 VRRIKFPKFVSSFF*RLSWLTLGGSSPPVSGGNLIGNIPSYTGCEVEGNCPSVAPLASTV 20 +R++KFP+F+SSFF RLS G SS N++GN PSY G +VEGN PS + A+T+ Sbjct: 192 IRKMKFPEFISSFFSRLSSPATGSSSTAAPSRNILGNAPSYAGRQVEGNYPS-SMGAATI 250 Query: 19 EPSDNS 2 EP +++ Sbjct: 251 EPPEDA 256 >ref|NP_191233.1| Ubiquitin-associated (UBA) protein [Arabidopsis thaliana] gi|9662993|emb|CAC00737.1| putative protein [Arabidopsis thaliana] gi|21553945|gb|AAM63026.1| unknown [Arabidopsis thaliana] gi|28950711|gb|AAO63279.1| At3g56740 [Arabidopsis thaliana] gi|110735889|dbj|BAE99920.1| hypothetical protein [Arabidopsis thaliana] gi|332646039|gb|AEE79560.1| Ubiquitin-associated (UBA) protein [Arabidopsis thaliana] Length = 293 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/66 (46%), Positives = 43/66 (65%) Frame = -2 Query: 199 VRRIKFPKFVSSFF*RLSWLTLGGSSPPVSGGNLIGNIPSYTGCEVEGNCPSVAPLASTV 20 +R+ KFP+FV+SFF RLS+ + G S PP N++G I TG E + P APL S+V Sbjct: 192 IRKAKFPEFVASFFSRLSFPSFGNSPPPAPSRNIVGTISPNTGRRAERSQP--APLPSSV 249 Query: 19 EPSDNS 2 EPS+ + Sbjct: 250 EPSEEA 255 >ref|XP_002876380.1| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322218|gb|EFH52639.1| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 293 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = -2 Query: 199 VRRIKFPKFVSSFF*RLSWLTLGGSSPPVSGGNLIGNIPSYTGCEVEGNCPSVAPLASTV 20 +R+ KFP+FV+SFF RLS+ + G S PP N++G I TG E + P AP+ S+V Sbjct: 192 IRKAKFPEFVASFFSRLSFPSFGNSPPPAPSRNIVGTISPNTGRRAERSQP--APVPSSV 249 Query: 19 EPSDNS 2 EPS+ + Sbjct: 250 EPSEEA 255 >ref|XP_003554120.1| PREDICTED: uncharacterized protein LOC100805217 isoform 1 [Glycine max] Length = 293 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/66 (40%), Positives = 44/66 (66%) Frame = -2 Query: 199 VRRIKFPKFVSSFF*RLSWLTLGGSSPPVSGGNLIGNIPSYTGCEVEGNCPSVAPLASTV 20 +R+ KFP+ +SSFF R+ ++G P S N++GN+PSY ++E N P AP+ + V Sbjct: 192 IRKAKFPEMISSFFSRILLPSMGSPRAPSSARNVVGNLPSYPARQMERNYP--APMQAAV 249 Query: 19 EPSDNS 2 EP+++S Sbjct: 250 EPTEDS 255 >ref|XP_003624969.1| Ubiquitin-associated domain-containing protein [Medicago truncatula] gi|355499984|gb|AES81187.1| Ubiquitin-associated domain-containing protein [Medicago truncatula] Length = 292 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = -2 Query: 199 VRRIKFPKFVSSFF*RLSWLTLGGSSPPVSGGNLIGNIPSYTGCEVEGNCPSVAPLASTV 20 +R+ KFP+F+SSFF R+S L G+ S N++GN+PSY ++E N P AP S V Sbjct: 192 IRKAKFPEFISSFFSRIS-LPSMGTPRTTSTRNVMGNVPSYPARQMERNYP--APTHSAV 248 Query: 19 EPSDNS 2 EPS++S Sbjct: 249 EPSEDS 254