BLASTX nr result
ID: Coptis21_contig00009037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00009037 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005090386.1| cytochrome c biogenesis Fn (mitochondrion) [... 48 2e-07 gb|AFR34318.1| cytochrome c biogenesis FN (mitochondrion) [Glyci... 48 2e-07 ref|YP_004222823.1| cytochrome c biogenesis FN [Vigna radiata] g... 48 2e-07 ref|YP_006460184.1| cytochrome c maturase subunit Fn (mitochondr... 48 1e-06 ref|YP_173394.1| cytochrome c maturation protein CcmFN [Nicotian... 48 1e-06 >ref|YP_005090386.1| cytochrome c biogenesis Fn (mitochondrion) [Phoenix dactylifera] gi|343478438|gb|AEM43926.1| cytochrome c biogenesis Fn (mitochondrion) [Phoenix dactylifera] Length = 594 Score = 47.8 bits (112), Expect(2) = 2e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -1 Query: 205 SLFRIAKMKFLQPQWYTPFVLRTLVDSELSSRRNQTF 95 S+ + + PQ YTPFVLRTLVDSEL SRRN+TF Sbjct: 128 SILSLQQKSGAAPQLYTPFVLRTLVDSELRSRRNRTF 164 Score = 32.3 bits (72), Expect(2) = 2e-07 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -3 Query: 104 PDLFYAPLYPGRKM 63 P LFYAPLYPGRKM Sbjct: 167 PALFYAPLYPGRKM 180 >gb|AFR34318.1| cytochrome c biogenesis FN (mitochondrion) [Glycine max] Length = 578 Score = 48.1 bits (113), Expect(3) = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 205 SLFRIAKMKFLQPQWYTPFVLRTLVDSELSSRRNQTF 95 SL R + PQ YTPFVLRTLVDSEL SRRN+TF Sbjct: 131 SLPRYEQKSGAAPQLYTPFVLRTLVDSELRSRRNRTF 167 Score = 30.4 bits (67), Expect(3) = 2e-07 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 104 PDLFYAPLYPGRKMRL 57 P LFYAPLYP RKM L Sbjct: 170 PALFYAPLYPERKMSL 185 Score = 20.4 bits (41), Expect(3) = 2e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 45 GSREGKRR 22 GSREGKRR Sbjct: 195 GSREGKRR 202 >ref|YP_004222823.1| cytochrome c biogenesis FN [Vigna radiata] gi|308206749|gb|ADO19886.1| cytochrome c biogenesis FN [Vigna radiata] Length = 578 Score = 48.1 bits (113), Expect(3) = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 205 SLFRIAKMKFLQPQWYTPFVLRTLVDSELSSRRNQTF 95 SL R + PQ YTPFVLRTLVDSEL SRRN+TF Sbjct: 131 SLPRYEQKSGAAPQLYTPFVLRTLVDSELRSRRNRTF 167 Score = 30.4 bits (67), Expect(3) = 2e-07 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 104 PDLFYAPLYPGRKMRL 57 P LFYAPLYP RKM L Sbjct: 170 PALFYAPLYPERKMSL 185 Score = 20.4 bits (41), Expect(3) = 2e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 45 GSREGKRR 22 GSREGKRR Sbjct: 195 GSREGKRR 202 >ref|YP_006460184.1| cytochrome c maturase subunit Fn (mitochondrion) [Mimulus guttatus] gi|340007649|gb|AEK26513.1| cytochrome c maturase subunit Fn (mitochondrion) [Mimulus guttatus] Length = 577 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 205 SLFRIAKMKFLQPQWYTPFVLRTLVDSELSSRRNQTF 95 SL R + QPQ YTPFV RTLVDSEL SRRN+TF Sbjct: 131 SLPRYEQKSGAQPQLYTPFVRRTLVDSELRSRRNRTF 167 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 104 PDLFYAPLYPGRKM 63 P LFYAPLYP RKM Sbjct: 170 PALFYAPLYPERKM 183 >ref|YP_173394.1| cytochrome c maturation protein CcmFN [Nicotiana tabacum] Length = 574 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 205 SLFRIAKMKFLQPQWYTPFVLRTLVDSELSSRRNQTF 95 SL R + PQ YTPFVLRTLVDSEL SRRN+TF Sbjct: 131 SLPRYEQKSGAAPQLYTPFVLRTLVDSELRSRRNRTF 167 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 104 PDLFYAPLYPGRKM 63 P LFYAPLYP RKM Sbjct: 170 PALFYAPLYPERKM 183