BLASTX nr result
ID: Coptis21_contig00008106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00008106 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220... 56 3e-06 >ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220238, partial [Cucumis sativus] Length = 169 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = -3 Query: 317 SYARVCVEINTECSYPDGVPIVIDER-RKFNVTFEYNWRPAWCACCDTFGHSAQKCPTNV 141 SYAR+CVE+N + + P + I ++ R +F V Y W+P C C +FGHS CP + Sbjct: 94 SYARICVELNVDSTMP--IEITVNLRGEEFIVPVTYEWKPRKCNLCHSFGHSQSTCPKKI 151 Query: 140 KVISDPRKGI 111 ++ + ++ + Sbjct: 152 EIEDNKKEAV 161