BLASTX nr result
ID: Coptis21_contig00007704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00007704 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH67252.1| OSIGBa0101C23.4 [Oryza sativa Indica Group] 56 3e-10 ref|XP_002270627.2| PREDICTED: uncharacterized protein LOC100266... 55 4e-10 emb|CBI16677.3| unnamed protein product [Vitis vinifera] 55 4e-10 ref|XP_002302497.1| predicted protein [Populus trichocarpa] gi|2... 55 9e-10 ref|XP_003526042.1| PREDICTED: uncharacterized protein LOC100815... 51 9e-10 >emb|CAH67252.1| OSIGBa0101C23.4 [Oryza sativa Indica Group] Length = 474 Score = 56.2 bits (134), Expect(2) = 3e-10 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +3 Query: 120 FQDGSYSRGPIEILVGAFDESKYFQSPTLTFEQ*SGNIAEVSGQHK 257 F+DGSYSRGP+++ +G FDESKYF SPT FEQ V G HK Sbjct: 250 FEDGSYSRGPVDLAIGEFDESKYFISPTYKFEQ-----CLVKGCHK 290 Score = 33.1 bits (74), Expect(2) = 3e-10 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 6/30 (20%) Frame = +1 Query: 1 LPGFESF------VLEEDFMGMEPGLVFFE 72 LP ESF VL+EDF+ EPG+V+FE Sbjct: 222 LPAHESFDLKKSDVLDEDFIAQEPGIVYFE 251 >ref|XP_002270627.2| PREDICTED: uncharacterized protein LOC100266721 [Vitis vinifera] Length = 507 Score = 55.1 bits (131), Expect(2) = 4e-10 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +3 Query: 120 FQDGSYSRGPIEILVGAFDESKYFQSPTLTFEQ*SGNIAEVSGQHK 257 F+DGSYSRGP+EI VG DESKY+ SPT FEQ V G HK Sbjct: 282 FEDGSYSRGPVEIPVGELDESKYYLSPTFKFEQ-----CLVKGCHK 322 Score = 33.9 bits (76), Expect(2) = 4e-10 Identities = 18/30 (60%), Positives = 20/30 (66%), Gaps = 6/30 (20%) Frame = +1 Query: 1 LPGFESF------VLEEDFMGMEPGLVFFE 72 LP FESF V++ED MG E GLVFFE Sbjct: 254 LPKFESFDFGTSDVMQEDIMGHESGLVFFE 283 >emb|CBI16677.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 55.1 bits (131), Expect(2) = 4e-10 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +3 Query: 120 FQDGSYSRGPIEILVGAFDESKYFQSPTLTFEQ*SGNIAEVSGQHK 257 F+DGSYSRGP+EI VG DESKY+ SPT FEQ V G HK Sbjct: 140 FEDGSYSRGPVEIPVGELDESKYYLSPTFKFEQ-----CLVKGCHK 180 Score = 33.9 bits (76), Expect(2) = 4e-10 Identities = 18/30 (60%), Positives = 20/30 (66%), Gaps = 6/30 (20%) Frame = +1 Query: 1 LPGFESF------VLEEDFMGMEPGLVFFE 72 LP FESF V++ED MG E GLVFFE Sbjct: 112 LPKFESFDFGTSDVMQEDIMGHESGLVFFE 141 >ref|XP_002302497.1| predicted protein [Populus trichocarpa] gi|222844223|gb|EEE81770.1| predicted protein [Populus trichocarpa] Length = 501 Score = 54.7 bits (130), Expect(2) = 9e-10 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +3 Query: 105 VHAIDFQDGSYSRGPIEILVGAFDESKYFQSPTLTFEQ*SGNIAEVSGQHK 257 V+ ++FQDGSYSRGP++I VG D+S Y+ SPT FEQ V G HK Sbjct: 275 VYTMNFQDGSYSRGPVDIPVGEVDDSNYYLSPTFKFEQ-----CLVKGCHK 320 Score = 33.1 bits (74), Expect(2) = 9e-10 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 6/27 (22%) Frame = +1 Query: 1 LPGFESF------VLEEDFMGMEPGLV 63 LPGFESF ++EED MG EPGLV Sbjct: 244 LPGFESFNFETSDLMEEDVMGNEPGLV 270 >ref|XP_003526042.1| PREDICTED: uncharacterized protein LOC100815601 [Glycine max] Length = 493 Score = 50.8 bits (120), Expect(2) = 9e-10 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = +3 Query: 120 FQDGSYSRGPIEILVGAFDESKYFQSPTLTFEQ*SGNIAEVSGQHK 257 F+DGSYSRGPI+I VG ++++KY+ SPT FEQ V G HK Sbjct: 270 FEDGSYSRGPIDIPVGEYNDTKYYISPTFKFEQ-----CLVKGCHK 310 Score = 37.0 bits (84), Expect(2) = 9e-10 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 6/30 (20%) Frame = +1 Query: 1 LPGFESF------VLEEDFMGMEPGLVFFE 72 LP FESF V+EED MG EPGLV+FE Sbjct: 242 LPTFESFDFKRSDVMEEDVMGCEPGLVYFE 271