BLASTX nr result
ID: Coptis21_contig00006093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00006093 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002441637.1| hypothetical protein SORBIDRAFT_09g030740 [S... 63 2e-08 ref|NP_001183616.1| uncharacterized protein LOC100502210 [Zea ma... 63 2e-08 ref|NP_001239779.1| uncharacterized protein LOC100808989 [Glycin... 62 5e-08 ref|NP_001242010.1| uncharacterized protein LOC100796450 [Glycin... 62 5e-08 dbj|BAB33035.1| CPRD48 [Vigna unguiculata] 62 5e-08 >ref|XP_002441637.1| hypothetical protein SORBIDRAFT_09g030740 [Sorghum bicolor] gi|241946922|gb|EES20067.1| hypothetical protein SORBIDRAFT_09g030740 [Sorghum bicolor] Length = 353 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 RPILHHYDGPKFRLELSVPEALALLDVFAE 92 RPILHHYDGPKFRLELSVPEAL+LLD+FAE Sbjct: 320 RPILHHYDGPKFRLELSVPEALSLLDIFAE 349 >ref|NP_001183616.1| uncharacterized protein LOC100502210 [Zea mays] gi|238013456|gb|ACR37763.1| unknown [Zea mays] gi|413948699|gb|AFW81348.1| hypothetical protein ZEAMMB73_956415 [Zea mays] Length = 297 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 RPILHHYDGPKFRLELSVPEALALLDVFAE 92 RPILHHYDGPKFRLELSVPEAL+LLD+FAE Sbjct: 260 RPILHHYDGPKFRLELSVPEALSLLDIFAE 289 >ref|NP_001239779.1| uncharacterized protein LOC100808989 [Glycine max] gi|255637142|gb|ACU18902.1| unknown [Glycine max] Length = 330 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 3 RPILHHYDGPKFRLELSVPEALALLDVFAE 92 RPILHHYDGPKFRLEL+VPEAL+LLD+FAE Sbjct: 288 RPILHHYDGPKFRLELNVPEALSLLDIFAE 317 >ref|NP_001242010.1| uncharacterized protein LOC100796450 [Glycine max] gi|255634801|gb|ACU17761.1| unknown [Glycine max] Length = 328 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 3 RPILHHYDGPKFRLELSVPEALALLDVFAE 92 RPILHHYDGPKFRLEL+VPEAL+LLD+FAE Sbjct: 286 RPILHHYDGPKFRLELNVPEALSLLDIFAE 315 >dbj|BAB33035.1| CPRD48 [Vigna unguiculata] Length = 71 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 3 RPILHHYDGPKFRLELSVPEALALLDVFAE 92 RPILHHYDGPKFRLEL+VPEAL+LLD+FAE Sbjct: 29 RPILHHYDGPKFRLELNVPEALSLLDIFAE 58