BLASTX nr result
ID: Coptis21_contig00005694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00005694 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]... 68 7e-10 ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]... 66 3e-09 ref|XP_002283777.2| PREDICTED: cytochrome P450 76A2 [Vitis vinif... 65 4e-09 emb|CBI30230.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]... 65 4e-09 >ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis] gi|223531942|gb|EEF33756.1| cytochrome P450, putative [Ricinus communis] Length = 515 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -2 Query: 335 LHLALGSLLHCFEWELDEPITPENIDMEERMGITLRKNVHLEVVPKTR 192 LHLAL SLLHCF+WEL TPE+IDM ER+GIT+RK V ++ +PK + Sbjct: 464 LHLALASLLHCFDWELGSNSTPESIDMNERLGITVRKLVPMKAIPKKK 511 >ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis] gi|223531943|gb|EEF33757.1| cytochrome P450, putative [Ricinus communis] Length = 514 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -2 Query: 335 LHLALGSLLHCFEWELDEPITPENIDMEERMGITLRKNVHLEVVPKTR 192 LHLAL SLLHCF+WEL TPE IDM ER+GI++RK V ++ +PK + Sbjct: 464 LHLALASLLHCFDWELGSNSTPETIDMNERLGISVRKLVPMKAIPKKK 511 >ref|XP_002283777.2| PREDICTED: cytochrome P450 76A2 [Vitis vinifera] Length = 512 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -2 Query: 335 LHLALGSLLHCFEWELDEPITPENIDMEERMGITLRKNVHLEVVPKTRDV 186 L LAL SLLHCF+WEL +TPE +DM ER+GIT+RK + L+ +PK R V Sbjct: 463 LPLALASLLHCFDWELGGGVTPETMDMNERVGITVRKLIPLKPIPKRRTV 512 >emb|CBI30230.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -2 Query: 335 LHLALGSLLHCFEWELDEPITPENIDMEERMGITLRKNVHLEVVPKTRDV 186 L LAL SLLHCF+WEL +TPE +DM ER+GIT+RK + L+ +PK R V Sbjct: 484 LPLALASLLHCFDWELGGGVTPETMDMNERVGITVRKLIPLKPIPKRRTV 533 >ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis] gi|223531938|gb|EEF33752.1| cytochrome P450, putative [Ricinus communis] Length = 524 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -2 Query: 335 LHLALGSLLHCFEWELDEPITPENIDMEERMGITLRKNVHLEVVPKTR 192 LHL L SLLHCF+WEL TP++IDM+E+MG+ +RK V L+ +PK R Sbjct: 474 LHLGLASLLHCFDWELSSNYTPDSIDMKEKMGMAVRKLVPLKAIPKKR 521