BLASTX nr result
ID: Coptis21_contig00005671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00005671 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27785.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002277706.1| PREDICTED: transmembrane protein 184C-like [... 59 4e-07 ref|XP_002516252.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_002324140.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_003561557.1| PREDICTED: transmembrane protein 184C-like [... 55 6e-06 >emb|CBI27785.3| unnamed protein product [Vitis vinifera] Length = 439 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 163 NSYFQVTDRDLHSPATIIAGSFILVALVLSIFPIFQHLRSYTNP 294 +S +Q T R+LH PA II G F++VAL+LSI IFQHLRSYT P Sbjct: 35 SSAYQGTYRNLHQPAVIIGGCFVVVALILSILLIFQHLRSYTKP 78 >ref|XP_002277706.1| PREDICTED: transmembrane protein 184C-like [Vitis vinifera] Length = 432 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 163 NSYFQVTDRDLHSPATIIAGSFILVALVLSIFPIFQHLRSYTNP 294 +S +Q T R+LH PA II G F++VAL+LSI IFQHLRSYT P Sbjct: 10 SSAYQGTYRNLHQPAVIIGGCFVVVALILSILLIFQHLRSYTKP 53 >ref|XP_002516252.1| conserved hypothetical protein [Ricinus communis] gi|223544738|gb|EEF46254.1| conserved hypothetical protein [Ricinus communis] Length = 418 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +1 Query: 190 DLHSPATIIAGSFILVALVLSIFPIFQHLRSYTNP 294 DLH PA II G F LVA+VLSIF IFQHLRSYTNP Sbjct: 15 DLHQPAVIIGGCFALVAVVLSIFLIFQHLRSYTNP 49 >ref|XP_002324140.1| predicted protein [Populus trichocarpa] gi|222865574|gb|EEF02705.1| predicted protein [Populus trichocarpa] Length = 412 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +1 Query: 172 FQVTDRDLHSPATIIAGSFILVALVLSIFPIFQHLRSYTNP 294 ++ T RDLH PA +I G F +VA++LSI+ IFQHL+SYTNP Sbjct: 5 YEDTYRDLHQPAVVIGGCFAIVAVLLSIYLIFQHLKSYTNP 45 >ref|XP_003561557.1| PREDICTED: transmembrane protein 184C-like [Brachypodium distachyon] Length = 461 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +1 Query: 154 LSSNSY--FQVTDRDLHSPATIIAGSFILVALVLSIFPIFQHLRSYTNPT 297 ++SN Y FQ R+LH+PA +I +F+LVAL++S++ I QHLRSY+NP+ Sbjct: 1 MASNEYSSFQGFYRNLHTPAVLIGAAFVLVALLISLWLILQHLRSYSNPS 50