BLASTX nr result
ID: Coptis21_contig00005073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00005073 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265438.2| PREDICTED: probable glycosyltransferase At5g... 71 1e-10 emb|CBI39073.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002525728.1| catalytic, putative [Ricinus communis] gi|22... 70 2e-10 ref|XP_003554026.1| PREDICTED: probable glycosyltransferase At5g... 69 4e-10 ref|XP_003624636.1| Exostosin-like protein [Medicago truncatula]... 67 2e-09 >ref|XP_002265438.2| PREDICTED: probable glycosyltransferase At5g03795-like [Vitis vinifera] Length = 336 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 259 VLQRNALKVRKHFQWNLFPTDYDAFYMVMYELWLRRNSLR 140 +LQ N LKVR HFQW++ P DYDAFYMVMYELWLRR+S+R Sbjct: 286 MLQSNVLKVRNHFQWHVSPVDYDAFYMVMYELWLRRSSVR 325 >emb|CBI39073.3| unnamed protein product [Vitis vinifera] Length = 467 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 259 VLQRNALKVRKHFQWNLFPTDYDAFYMVMYELWLRRNSLR 140 +LQ N LKVR HFQW++ P DYDAFYMVMYELWLRR+S+R Sbjct: 405 MLQSNVLKVRNHFQWHVSPVDYDAFYMVMYELWLRRSSVR 444 >ref|XP_002525728.1| catalytic, putative [Ricinus communis] gi|223535028|gb|EEF36711.1| catalytic, putative [Ricinus communis] Length = 336 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 259 VLQRNALKVRKHFQWNLFPTDYDAFYMVMYELWLRRNSLR 140 +LQ N LKVRKHFQW+ P DYDAF+MVMYELWLRR+S+R Sbjct: 286 MLQSNVLKVRKHFQWHFPPVDYDAFHMVMYELWLRRSSVR 325 >ref|XP_003554026.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine max] Length = 487 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 259 VLQRNALKVRKHFQWNLFPTDYDAFYMVMYELWLRRNSLRFT 134 +LQ N LKVRKHFQW+ P D+DAFYMVMYELWLRR+S++ T Sbjct: 439 MLQSNVLKVRKHFQWHSPPQDFDAFYMVMYELWLRRSSIKNT 480 >ref|XP_003624636.1| Exostosin-like protein [Medicago truncatula] gi|87162615|gb|ABD28410.1| Exostosin-like [Medicago truncatula] gi|116831751|gb|ABK28848.1| exostosin-like protein [Medicago truncatula] gi|355499651|gb|AES80854.1| Exostosin-like protein [Medicago truncatula] Length = 486 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 259 VLQRNALKVRKHFQWNLFPTDYDAFYMVMYELWLRRNSL 143 +LQ+N LKVR+HFQW+ P D+DAFYMVMYELWLRR+S+ Sbjct: 441 MLQKNVLKVREHFQWHSPPIDFDAFYMVMYELWLRRSSI 479