BLASTX nr result
ID: Coptis21_contig00004516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00004516 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145003.1| PREDICTED: SNF1-related protein kinase catal... 55 8e-06 emb|CAA71142.1| SNF1-related protein kinase [Cucumis sativus] 55 8e-06 >ref|XP_004145003.1| PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like [Cucumis sativus] gi|449474166|ref|XP_004154092.1| PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like [Cucumis sativus] gi|449498915|ref|XP_004160670.1| PREDICTED: SNF1-related protein kinase catalytic subunit alpha KIN10-like [Cucumis sativus] Length = 515 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -1 Query: 122 DSSFSRMHPSEPAASAMGHRFVGYMDYQGIGLRPHF 15 ++ F+RMHPS+P A+GHR GYMDYQG+GLR F Sbjct: 351 ETGFNRMHPSDPTNPAVGHRLPGYMDYQGMGLRAQF 386 >emb|CAA71142.1| SNF1-related protein kinase [Cucumis sativus] Length = 504 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -1 Query: 122 DSSFSRMHPSEPAASAMGHRFVGYMDYQGIGLRPHF 15 ++ F+RMHPS+P A+GHR GYMDYQG+GLR F Sbjct: 340 ETGFNRMHPSDPTNPAVGHRLPGYMDYQGMGLRAQF 375