BLASTX nr result
ID: Coptis21_contig00003558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00003558 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABH07428.1| vacuolar H+-ATPase subunit C [Gossypium hirsutum] 86 3e-15 ref|XP_002275510.1| PREDICTED: V-type proton ATPase subunit C [V... 83 3e-14 ref|XP_004150739.1| PREDICTED: V-type proton ATPase subunit C-li... 82 6e-14 dbj|BAE98945.1| vacuolar ATP sythase subunit C [Arabidopsis thal... 81 8e-14 ref|NP_563916.1| V-type proton ATPase subunit C [Arabidopsis tha... 81 8e-14 >gb|ABH07428.1| vacuolar H+-ATPase subunit C [Gossypium hirsutum] Length = 377 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = -2 Query: 416 EKKVRSILEGVCDSRNSNFWSSEEEVGAMAGLGGDTDTHPYVSFTINL 273 EKKVRSILEG+CDS NS +W +E+E GAMAGLGGDTD HPYVSFTIN+ Sbjct: 329 EKKVRSILEGLCDSANSTYWKTEDEGGAMAGLGGDTDAHPYVSFTINI 376 >ref|XP_002275510.1| PREDICTED: V-type proton ATPase subunit C [Vitis vinifera] gi|296082286|emb|CBI21291.3| unnamed protein product [Vitis vinifera] Length = 375 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -2 Query: 416 EKKVRSILEGVCDSRNSNFWSSEEEVGAMAGLGGDTDTHPYVSFTINL 273 EKKVRSILEG+CDS NS FW SE++ G MAGLGGD D HPYV FTINL Sbjct: 327 EKKVRSILEGLCDSTNSAFWKSEDDAGGMAGLGGDADAHPYVCFTINL 374 >ref|XP_004150739.1| PREDICTED: V-type proton ATPase subunit C-like [Cucumis sativus] gi|449518489|ref|XP_004166274.1| PREDICTED: V-type proton ATPase subunit C-like [Cucumis sativus] Length = 376 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/49 (77%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = -2 Query: 416 EKKVRSILEGVCDSRNSNFWSSEEEV-GAMAGLGGDTDTHPYVSFTINL 273 EKKVRSILEG+CDS NS +W +E+EV G MAGLGGD+D HPYVSFTINL Sbjct: 327 EKKVRSILEGLCDSANSTYWKTEDEVGGGMAGLGGDSDAHPYVSFTINL 375 >dbj|BAE98945.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana] Length = 263 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -2 Query: 416 EKKVRSILEGVCDSRNSNFWSSEEEVGAMAGLGGDTDTHPYVSFTINL 273 EKKVRSILE +CDS NS +W SEE+ GAMAGL GD++THPYVSFTINL Sbjct: 215 EKKVRSILERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL 262 >ref|NP_563916.1| V-type proton ATPase subunit C [Arabidopsis thaliana] gi|12585488|sp|Q9SDS7.1|VATC_ARATH RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase subunit C; AltName: Full=Vacuolar H(+)-ATPase subunit C; AltName: Full=Vacuolar proton pump subunit C gi|6636332|gb|AAF20146.1|AF208261_1 vacuolar ATP synthase subunit C [Arabidopsis thaliana] gi|8698731|gb|AAF78489.1|AC012187_9 Identical to vacuolar ATP sythase subunit C (DET3) from Arabidopsis thaliana gb|AF208261. ESTs gb|AA067533, gb|Z37481, gb|AA721838, gb|Z37180, gb|T21206 come from this gene [Arabidopsis thaliana] gi|12248023|gb|AAG50103.1|AF334725_1 putative vacuolar ATP synthase subunit C [Arabidopsis thaliana] gi|16649005|gb|AAL24354.1| Identical to vacuolar ATP sythase subunit C (DET3) [Arabidopsis thaliana] gi|20259972|gb|AAM13333.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana] gi|225897918|dbj|BAH30291.1| hypothetical protein [Arabidopsis thaliana] gi|332190815|gb|AEE28936.1| V-type proton ATPase subunit C [Arabidopsis thaliana] Length = 375 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -2 Query: 416 EKKVRSILEGVCDSRNSNFWSSEEEVGAMAGLGGDTDTHPYVSFTINL 273 EKKVRSILE +CDS NS +W SEE+ GAMAGL GD++THPYVSFTINL Sbjct: 327 EKKVRSILERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINL 374