BLASTX nr result
ID: Coptis21_contig00003453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00003453 (2082 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19139.3| unnamed protein product [Vitis vinifera] 77 2e-11 ref|XP_002285804.1| PREDICTED: uncharacterized WD repeat-contain... 77 2e-11 ref|XP_002513893.1| WD-repeat protein, putative [Ricinus communi... 74 1e-10 ref|NP_565168.4| transducin/WD-40 repeat-containing protein [Ara... 72 4e-10 gb|AAF17690.1|AC009243_17 F28K19.28 [Arabidopsis thaliana] 72 4e-10 >emb|CBI19139.3| unnamed protein product [Vitis vinifera] Length = 591 Score = 76.6 bits (187), Expect = 2e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 2 QYKNFENLSRSHDELDKEMKKVEGGGNFYEFQFNTRLVKSTIVHFQ 139 QYKN+ENLSR +EL+K+ KK+E G FY+FQFNTRLVKSTIVHFQ Sbjct: 91 QYKNYENLSRPREELEKDCKKIEKGSTFYDFQFNTRLVKSTIVHFQ 136 >ref|XP_002285804.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03 [Vitis vinifera] Length = 450 Score = 76.6 bits (187), Expect = 2e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 2 QYKNFENLSRSHDELDKEMKKVEGGGNFYEFQFNTRLVKSTIVHFQ 139 QYKN+ENLSR +EL+K+ KK+E G FY+FQFNTRLVKSTIVHFQ Sbjct: 91 QYKNYENLSRPREELEKDCKKIEKGSTFYDFQFNTRLVKSTIVHFQ 136 >ref|XP_002513893.1| WD-repeat protein, putative [Ricinus communis] gi|223546979|gb|EEF48476.1| WD-repeat protein, putative [Ricinus communis] Length = 447 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 2 QYKNFENLSRSHDELDKEMKKVEGGGNFYEFQFNTRLVKSTIVHFQ 139 QYKN+ENLSRS +L KE +VE G NFY+FQFNTRLVKSTIVHFQ Sbjct: 88 QYKNYENLSRSRQDLHKECLQVEKGKNFYDFQFNTRLVKSTIVHFQ 133 >ref|NP_565168.4| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|13937195|gb|AAK50091.1|AF372951_1 At1g78070/F28K19_28 [Arabidopsis thaliana] gi|25090156|gb|AAN72242.1| At1g78070/F28K19_28 [Arabidopsis thaliana] gi|332197943|gb|AEE36064.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Length = 449 Score = 72.4 bits (176), Expect = 4e-10 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 5 YKNFENLSRSHDELDKEMKKVEGGGNFYEFQFNTRLVKSTIVHFQ 139 YKNFE+L RS +ELDKE +VE G NFY+FQFNTRLVKSTI HFQ Sbjct: 91 YKNFESLFRSREELDKECLQVEKGKNFYDFQFNTRLVKSTIAHFQ 135 >gb|AAF17690.1|AC009243_17 F28K19.28 [Arabidopsis thaliana] Length = 523 Score = 72.4 bits (176), Expect = 4e-10 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 5 YKNFENLSRSHDELDKEMKKVEGGGNFYEFQFNTRLVKSTIVHFQ 139 YKNFE+L RS +ELDKE +VE G NFY+FQFNTRLVKSTI HFQ Sbjct: 102 YKNFESLFRSREELDKECLQVEKGKNFYDFQFNTRLVKSTIAHFQ 146