BLASTX nr result
ID: Coptis21_contig00003215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00003215 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001031809.1| pathogenesis-related thaumatin-like protein ... 71 1e-10 ref|NP_568046.1| pathogenesis-related thaumatin-like protein [Ar... 69 5e-10 gb|AAM64698.1| putative thaumatin-like protein [Arabidopsis thal... 69 5e-10 ref|XP_003589504.1| Thaumatin-like protein [Medicago truncatula]... 68 7e-10 ref|XP_004159719.1| PREDICTED: thaumatin-like protein 1-like [Cu... 68 9e-10 >ref|NP_001031809.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana] gi|4467153|emb|CAB37522.1| putative thaumatin-like protein [Arabidopsis thaliana] gi|7270849|emb|CAB80530.1| putative thaumatin-like protein [Arabidopsis thaliana] gi|332661560|gb|AEE86960.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana] Length = 323 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +1 Query: 85 MISGSFSATFTFQNKCPYTVWPGILNNPNVPTFPSTGFELQNGASQSFDV-QGWAG 249 M+ GS+ +TFTF N+C YTVWPGIL+N PT +TGFEL G S+S GW+G Sbjct: 1 MLKGSYGSTFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSG 56 >ref|NP_568046.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana] gi|17979355|gb|AAL49903.1| putative thaumatin protein [Arabidopsis thaliana] gi|20466021|gb|AAM20232.1| putative thaumatin [Arabidopsis thaliana] gi|110737096|dbj|BAF00500.1| thaumatin-like protein [Arabidopsis thaliana] gi|332661559|gb|AEE86959.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana] Length = 345 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +1 Query: 91 SGSFSATFTFQNKCPYTVWPGILNNPNVPTFPSTGFELQNGASQSFDV-QGWAG 249 +GS+ +TFTF N+C YTVWPGIL+N PT +TGFEL G S+S GW+G Sbjct: 25 TGSYGSTFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSG 78 >gb|AAM64698.1| putative thaumatin-like protein [Arabidopsis thaliana] Length = 345 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +1 Query: 91 SGSFSATFTFQNKCPYTVWPGILNNPNVPTFPSTGFELQNGASQSFDV-QGWAG 249 +GS+ +TFTF N+C YTVWPGIL+N PT +TGFEL G S+S GW+G Sbjct: 25 TGSYGSTFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSG 78 >ref|XP_003589504.1| Thaumatin-like protein [Medicago truncatula] gi|355478552|gb|AES59755.1| Thaumatin-like protein [Medicago truncatula] Length = 323 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/57 (56%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +1 Query: 82 IMISGSFSATFTFQNKCPYTVWPGILNNPNVPTFPSTGFELQNGASQSFDV-QGWAG 249 + ISG S TFTF NKC YTVWPGIL+N VPT P+TGF LQ G + + W G Sbjct: 15 LSISGVISTTFTFVNKCDYTVWPGILSNAGVPTLPTTGFVLQTGETTTVAAPASWGG 71 >ref|XP_004159719.1| PREDICTED: thaumatin-like protein 1-like [Cucumis sativus] Length = 308 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +1 Query: 79 FIMISGSFSATFTFQNKCPYTVWPGILNNPNVPTFPSTGFELQNGASQSFDV-QGWAG 249 F+ + GSF A FTF NKC +TVWPG+L+ F +TGFEL+ G+S+SF GW+G Sbjct: 13 FLTLHGSFGAKFTFVNKCDFTVWPGVLSGAGSLKFDTTGFELRKGSSRSFQAPAGWSG 70