BLASTX nr result
ID: Coptis21_contig00003124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00003124 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528924.1| PREDICTED: cytochrome P450 704C1-like [Glyci... 55 8e-06 >ref|XP_003528924.1| PREDICTED: cytochrome P450 704C1-like [Glycine max] Length = 509 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 1 VFTSVLLHFFAFELWDKKKPVNYKTMITLHIDGPLNLRASPRVRD 135 +F++VLL F F+L D+KK V+YKTMITLHIDG L ++A R RD Sbjct: 465 IFSAVLLGCFHFKLNDEKKNVSYKTMITLHIDGGLEIKAFHRYRD 509