BLASTX nr result
ID: Coptis21_contig00002931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00002931 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16907.3| unnamed protein product [Vitis vinifera] 129 3e-28 ref|XP_002278588.1| PREDICTED: protein furry homolog-like [Vitis... 129 3e-28 emb|CAN67023.1| hypothetical protein VITISV_036510 [Vitis vinifera] 129 3e-28 ref|XP_002534056.1| conserved hypothetical protein [Ricinus comm... 127 7e-28 ref|XP_003555021.1| PREDICTED: protein furry-like [Glycine max] 126 2e-27 >emb|CBI16907.3| unnamed protein product [Vitis vinifera] Length = 2073 Score = 129 bits (323), Expect = 3e-28 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = +3 Query: 3 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLILKALLQHTAMDAAQSPHVYAIVSQLVES 182 EWFPKHSALAFGHLLRLLEKGPVEYQRVILL+LKALLQHT MDAAQSPH+YAIVSQLVES Sbjct: 1892 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLMLKALLQHTPMDAAQSPHMYAIVSQLVES 1951 Query: 183 TLCWD 197 TLCW+ Sbjct: 1952 TLCWE 1956 >ref|XP_002278588.1| PREDICTED: protein furry homolog-like [Vitis vinifera] Length = 2150 Score = 129 bits (323), Expect = 3e-28 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = +3 Query: 3 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLILKALLQHTAMDAAQSPHVYAIVSQLVES 182 EWFPKHSALAFGHLLRLLEKGPVEYQRVILL+LKALLQHT MDAAQSPH+YAIVSQLVES Sbjct: 1969 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLMLKALLQHTPMDAAQSPHMYAIVSQLVES 2028 Query: 183 TLCWD 197 TLCW+ Sbjct: 2029 TLCWE 2033 >emb|CAN67023.1| hypothetical protein VITISV_036510 [Vitis vinifera] Length = 1916 Score = 129 bits (323), Expect = 3e-28 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = +3 Query: 3 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLILKALLQHTAMDAAQSPHVYAIVSQLVES 182 EWFPKHSALAFGHLLRLLEKGPVEYQRVILL+LKALLQHT MDAAQSPH+YAIVSQLVES Sbjct: 1735 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLMLKALLQHTPMDAAQSPHMYAIVSQLVES 1794 Query: 183 TLCWD 197 TLCW+ Sbjct: 1795 TLCWE 1799 >ref|XP_002534056.1| conserved hypothetical protein [Ricinus communis] gi|223525919|gb|EEF28327.1| conserved hypothetical protein [Ricinus communis] Length = 1665 Score = 127 bits (320), Expect = 7e-28 Identities = 60/65 (92%), Positives = 64/65 (98%) Frame = +3 Query: 3 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLILKALLQHTAMDAAQSPHVYAIVSQLVES 182 EWFPKHSALAFGHLLRLLEKGPVEYQRVILL+LKALLQHT MDA+QSPH+YAIVSQLVES Sbjct: 1487 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLMLKALLQHTPMDASQSPHMYAIVSQLVES 1546 Query: 183 TLCWD 197 TLCW+ Sbjct: 1547 TLCWE 1551 >ref|XP_003555021.1| PREDICTED: protein furry-like [Glycine max] Length = 2141 Score = 126 bits (317), Expect = 2e-27 Identities = 59/65 (90%), Positives = 62/65 (95%) Frame = +3 Query: 3 EWFPKHSALAFGHLLRLLEKGPVEYQRVILLILKALLQHTAMDAAQSPHVYAIVSQLVES 182 EWFPKHS LAFGHLLRLLEKGPVEYQRVILL+LKALLQHT MDA QSPH+YAIVSQLVES Sbjct: 1960 EWFPKHSTLAFGHLLRLLEKGPVEYQRVILLMLKALLQHTPMDATQSPHIYAIVSQLVES 2019 Query: 183 TLCWD 197 TLCW+ Sbjct: 2020 TLCWE 2024