BLASTX nr result
ID: Coptis21_contig00000392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00000392 (559 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF18432.1|AF192261_1 Rar1 [Hordeum vulgare] gi|9623337|gb|AA... 72 6e-11 dbj|BAK04253.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 6e-11 sp|Q6EPW7.2|RAR1_ORYSJ RecName: Full=Cysteine and histidine-rich... 72 6e-11 ref|XP_003572584.1| PREDICTED: cysteine and histidine-rich domai... 72 8e-11 gb|ABN13684.1| RAR1 [Triticum aestivum] 72 8e-11 >gb|AAF18432.1|AF192261_1 Rar1 [Hordeum vulgare] gi|9623337|gb|AAF90123.1|AF254799_3 Rar1 [Hordeum vulgare] Length = 232 Score = 72.0 bits (175), Expect = 6e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 CTYHASGPIFHDGKKEWSCCHQKSHDFSLFLALPG 107 C YH SGP+FHDG KEWSCC Q+SHDFSLFLA+PG Sbjct: 38 CHYHPSGPLFHDGMKEWSCCKQRSHDFSLFLAIPG 72 >dbj|BAK04253.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 327 Score = 72.0 bits (175), Expect = 6e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 CTYHASGPIFHDGKKEWSCCHQKSHDFSLFLALPG 107 C YH SGP+FHDG KEWSCC Q+SHDFSLFLA+PG Sbjct: 133 CHYHPSGPLFHDGMKEWSCCKQRSHDFSLFLAIPG 167 >sp|Q6EPW7.2|RAR1_ORYSJ RecName: Full=Cysteine and histidine-rich domain-containing protein RAR1; AltName: Full=CHORD domain-containing protein RAR1; AltName: Full=OsRAR1; AltName: Full=Protein REQUIRED FOR MLA12 RESISTANCE 1 Length = 233 Score = 72.0 bits (175), Expect = 6e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 CTYHASGPIFHDGKKEWSCCHQKSHDFSLFLALPG 107 C YH SGP+FHDG K+WSCC QKSHDFSLFLA+PG Sbjct: 45 CQYHPSGPMFHDGMKQWSCCKQKSHDFSLFLAIPG 79 >ref|XP_003572584.1| PREDICTED: cysteine and histidine-rich domain-containing protein RAR1-like [Brachypodium distachyon] Length = 292 Score = 71.6 bits (174), Expect = 8e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 CTYHASGPIFHDGKKEWSCCHQKSHDFSLFLALPG 107 C YH SGP+FHDG KEWSCC Q+SHDFSLFLA+PG Sbjct: 101 CHYHPSGPMFHDGMKEWSCCKQRSHDFSLFLAIPG 135 >gb|ABN13684.1| RAR1 [Triticum aestivum] Length = 231 Score = 71.6 bits (174), Expect = 8e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 CTYHASGPIFHDGKKEWSCCHQKSHDFSLFLALPG 107 C YH SGP+FHDG KEWSCC Q+SHDFSLFLA+PG Sbjct: 38 CHYHPSGPMFHDGMKEWSCCKQRSHDFSLFLAIPG 72