BLASTX nr result
ID: Coptis21_contig00000269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00000269 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278719.1| PREDICTED: pentatricopeptide repeat-containi... 75 4e-12 ref|XP_003554900.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_003618546.1| Pentatricopeptide repeat-containing protein ... 67 1e-09 ref|XP_002324074.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 ref|XP_004144616.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 >ref|XP_002278719.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Vitis vinifera] Length = 632 Score = 75.5 bits (184), Expect = 4e-12 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 6/93 (6%) Frame = +3 Query: 3 GDKSHPQTQDVYLMLDEMSQKLRLVGYIPNNXXXXXXXXXXXXDNVNLKEEKERVLFSQ* 182 GDKSHP+T++VY MLDEM +LRL GY PN D++ +EEKE+ LFS Sbjct: 506 GDKSHPRTREVYNMLDEMIPRLRLAGYAPNTALQTFAGCDSLEDDLVEQEEKEQALFSHS 565 Query: 183 EVGHLLW------TRMLLHI*RNLKICQDCHCA 263 E + + + LHI +NL+ICQDCH A Sbjct: 566 EKLAICFGLISTGPGVPLHIFKNLRICQDCHSA 598 >ref|XP_003554900.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Glycine max] Length = 629 Score = 70.9 bits (172), Expect = 1e-10 Identities = 41/93 (44%), Positives = 52/93 (55%), Gaps = 6/93 (6%) Frame = +3 Query: 3 GDKSHPQTQDVYLMLDEMSQKLRLVGYIPNNXXXXXXXXXXXXDNVNLKEEKERVLFSQ* 182 GDKSHP+T D+Y+ LD+M KLRL GY+PN D + EE E+VLF+ Sbjct: 503 GDKSHPRTADIYMKLDDMICKLRLAGYVPNTNCQVLFGCSNGDDCMEAFEEVEQVLFTHS 562 Query: 183 EVGHLLWTRML------LHI*RNLKICQDCHCA 263 E L + M L I +NL+ICQDCH A Sbjct: 563 EKLALCFGLMSTPSSSPLCIFKNLRICQDCHSA 595 >ref|XP_003618546.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355493561|gb|AES74764.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 637 Score = 67.4 bits (163), Expect = 1e-09 Identities = 39/93 (41%), Positives = 50/93 (53%), Gaps = 6/93 (6%) Frame = +3 Query: 3 GDKSHPQTQDVYLMLDEMSQKLRLVGYIPNNXXXXXXXXXXXXDNVNLKEEKERVLFSQ* 182 GDKSH +T ++Y+ LDEM +LR GY+PN D EE E+VLF+ Sbjct: 511 GDKSHTRTSEIYMKLDEMICRLRSAGYVPNTSCQVLFGCSNRDDCSESLEEVEQVLFTHS 570 Query: 183 EVGHLLWTRML------LHI*RNLKICQDCHCA 263 E L + M LHI +NL+ICQDCH A Sbjct: 571 EKLALCFGLMSTPSGSPLHIFKNLRICQDCHSA 603 >ref|XP_002324074.1| predicted protein [Populus trichocarpa] gi|222867076|gb|EEF04207.1| predicted protein [Populus trichocarpa] Length = 636 Score = 65.1 bits (157), Expect = 6e-09 Identities = 38/93 (40%), Positives = 50/93 (53%), Gaps = 6/93 (6%) Frame = +3 Query: 3 GDKSHPQTQDVYLMLDEMSQKLRLVGYIPNNXXXXXXXXXXXXDNVNLKEEKERVLFSQ* 182 GDKSHP T+++Y L+ M Q+LRL GY+PN + EEKE+ LF Sbjct: 510 GDKSHPLTKEIYHALNNMIQRLRLAGYVPNTTNQVFPGSDGREGSSEEMEEKEQALFLHS 569 Query: 183 E-----VGHL-LWTRMLLHI*RNLKICQDCHCA 263 E GH+ L+I +NL+ICQDCH A Sbjct: 570 EKLAVCFGHISTKPGAPLYIFKNLRICQDCHSA 602 >ref|XP_004144616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449511814|ref|XP_004164061.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 681 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 2/105 (1%) Frame = +3 Query: 3 GDKSHPQTQDVYLMLDEMSQKLRLVGYIPNNXXXXXXXXXXXXDNVNLKEEKER--VLFS 176 GDKSHPQT+++Y+ L EM +KL + G+IP+ L+ ER + F Sbjct: 563 GDKSHPQTEEIYIKLCEMKKKLNVAGHIPDTTQVLLCLEEDNEKEAELETHSERLAIAFG 622 Query: 177 Q*EVGHLLWTRMLLHI*RNLKICQDCHCAAPKHGHV*NFTVSASD 311 + H R++ +NL+IC DCH H+ N + D Sbjct: 623 LLNIKHGSPIRII----KNLRICNDCHAVTKLLSHIYNREIIIRD 663