BLASTX nr result
ID: Coptis21_contig00000218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00000218 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_175268.1| 50S ribosomal protein L18 [Arabidopsis thaliana... 105 4e-21 ref|XP_002891426.1| ribosomal protein L18 family protein [Arabid... 105 4e-21 ref|XP_004147640.1| PREDICTED: 50S ribosomal protein L18, chloro... 103 1e-20 ref|XP_002509912.1| 50S ribosomal protein L18, chloroplast precu... 103 1e-20 gb|AFK34990.1| unknown [Lotus japonicus] gi|388495768|gb|AFK3595... 100 1e-19 >ref|NP_175268.1| 50S ribosomal protein L18 [Arabidopsis thaliana] gi|73621536|sp|Q9SX68.1|RK18_ARATH RecName: Full=50S ribosomal protein L18, chloroplastic; AltName: Full=CL18; Flags: Precursor gi|5733872|gb|AAD49760.1|AC007932_8 Similar to 50S Ribosomal protein L18 from Thermotoga maritima gb|AE001798. ESTs gb|AI993387, gb|T75951 and gb|T22182 come from this gene [Arabidopsis thaliana] gi|12484209|gb|AAG54003.1|AF336922_1 putative ribosomal protein L18 [Arabidopsis thaliana] gi|110740956|dbj|BAE98573.1| hypothetical protein [Arabidopsis thaliana] gi|332194156|gb|AEE32277.1| 50S ribosomal protein L18 [Arabidopsis thaliana] Length = 170 Score = 105 bits (262), Expect = 4e-21 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +1 Query: 1 YTSGPTIEIAKKVGEVIAKACLEKGIQKVAFDHGGYPYHGRIEALADAAREHGLQ 165 YTSGPTIE+AKKVGEVIAK+CLEKGI KVAFD GGYPYHGRIEALA AAREHGLQ Sbjct: 115 YTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAAREHGLQ 169 >ref|XP_002891426.1| ribosomal protein L18 family protein [Arabidopsis lyrata subsp. lyrata] gi|297337268|gb|EFH67685.1| ribosomal protein L18 family protein [Arabidopsis lyrata subsp. lyrata] Length = 170 Score = 105 bits (262), Expect = 4e-21 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +1 Query: 1 YTSGPTIEIAKKVGEVIAKACLEKGIQKVAFDHGGYPYHGRIEALADAAREHGLQ 165 YTSGPTIE+AKKVGEVIAK+CLEKGI KVAFD GGYPYHGRIEALA AAREHGLQ Sbjct: 115 YTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALAAAAREHGLQ 169 >ref|XP_004147640.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Cucumis sativus] gi|449498793|ref|XP_004160635.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Cucumis sativus] Length = 170 Score = 103 bits (257), Expect = 1e-20 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = +1 Query: 1 YTSGPTIEIAKKVGEVIAKACLEKGIQKVAFDHGGYPYHGRIEALADAAREHGLQ 165 Y++GPTIE+AKK+GE IAK+CLEKGI KVAFD GGYPYHGR+EALADAAREHGLQ Sbjct: 115 YSAGPTIEVAKKIGEAIAKSCLEKGITKVAFDRGGYPYHGRVEALADAAREHGLQ 169 >ref|XP_002509912.1| 50S ribosomal protein L18, chloroplast precursor, putative [Ricinus communis] gi|223549811|gb|EEF51299.1| 50S ribosomal protein L18, chloroplast precursor, putative [Ricinus communis] Length = 164 Score = 103 bits (257), Expect = 1e-20 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = +1 Query: 1 YTSGPTIEIAKKVGEVIAKACLEKGIQKVAFDHGGYPYHGRIEALADAAREHGLQ 165 Y+SGPT+E+AKKVGEVIAK+CLEKGI KVAFD GGYPYHGRIEALADAARE+GLQ Sbjct: 109 YSSGPTLEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEALADAARENGLQ 163 >gb|AFK34990.1| unknown [Lotus japonicus] gi|388495768|gb|AFK35950.1| unknown [Lotus japonicus] Length = 162 Score = 100 bits (250), Expect = 1e-19 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = +1 Query: 1 YTSGPTIEIAKKVGEVIAKACLEKGIQKVAFDHGGYPYHGRIEALADAAREHGL 162 YT+GPTIE+AKKVGE+IAK+CLEKGI KVAFD GGYPYHGR++ALADAARE+GL Sbjct: 107 YTAGPTIEVAKKVGEIIAKSCLEKGITKVAFDRGGYPYHGRVQALADAARENGL 160