BLASTX nr result
ID: Cocculus23_contig00062061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00062061 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323569.2| hypothetical protein POPTR_0016s12140g [Popu... 56 6e-06 >ref|XP_002323569.2| hypothetical protein POPTR_0016s12140g [Populus trichocarpa] gi|550321324|gb|EEF05330.2| hypothetical protein POPTR_0016s12140g [Populus trichocarpa] Length = 425 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/50 (48%), Positives = 38/50 (76%) Frame = +1 Query: 130 SVEEEIDEIDHNEGPDTLVCPLNLTLEERKAWFKEKLPEFGILKSTALSR 279 S++EEI E+D +E +++ P +LT+EER WF++K+PEF ILKS L++ Sbjct: 80 SMQEEIKEVDRSENQSSVIPPFSLTVEERIEWFRKKVPEFEILKSDNLTK 129