BLASTX nr result
ID: Cocculus23_contig00062024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00062024 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME47644.1| hypothetical protein DOTSEDRAFT_69561 [Dothistrom... 62 6e-08 >gb|EME47644.1| hypothetical protein DOTSEDRAFT_69561 [Dothistroma septosporum NZE10] Length = 71 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/66 (48%), Positives = 39/66 (59%) Frame = +1 Query: 46 EETTESAAQLKNDIPNYGMKENKKEGHVGNKNYGVGGTDKDGGLSTADTVAXXXXXXXXX 225 E ++ Q+K+ + YG+ ENKKE H GN N VGGT KDGGLSTADTVA Sbjct: 5 EHNKSNSEQVKDGL-EYGVNENKKEAHTGNPNRNVGGTAKDGGLSTADTVADGGPDDAEE 63 Query: 226 XXXFKP 243 +KP Sbjct: 64 DGEYKP 69