BLASTX nr result
ID: Cocculus23_contig00061784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00061784 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45509.1| hypothetical protein DOTSEDRAFT_71275 [Dothistrom... 60 4e-07 >gb|EME45509.1| hypothetical protein DOTSEDRAFT_71275 [Dothistroma septosporum NZE10] Length = 341 Score = 59.7 bits (143), Expect = 4e-07 Identities = 34/82 (41%), Positives = 44/82 (53%) Frame = +1 Query: 7 SIRAQFRSQLCTASCRPQTASLAKALVSPTLSLVRYQTSGMDRIDTKAEAKIGEKKLXXX 186 + R Q +SQLCTA+ RPQ ++ K L L +Y T+ MD ID K E KIG KKL Sbjct: 26 AFRPQLKSQLCTAAKRPQNFAMKKPLALQ-LMRAKYATAPMDTIDKKVEEKIGAKKLPSD 84 Query: 187 XXXXXXXXXIHPVLGEVGQEES 252 HPV E+G +E+ Sbjct: 85 PETVSLTSSTHPVNSEIGVQEA 106