BLASTX nr result
ID: Cocculus23_contig00060863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00060863 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003852804.1| hypothetical protein MYCGRDRAFT_92250 [Zymos... 65 7e-09 gb|EME82997.1| hypothetical protein MYCFIDRAFT_215158 [Pseudocer... 60 4e-07 >ref|XP_003852804.1| hypothetical protein MYCGRDRAFT_92250 [Zymoseptoria tritici IPO323] gi|339472686|gb|EGP87780.1| hypothetical protein MYCGRDRAFT_92250 [Zymoseptoria tritici IPO323] Length = 676 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = +2 Query: 2 ELLDEPQSTRQRHRFTLVRQAGQDPIRGGDNAATRPNKFEVEAYKEDKRLRG 157 E LD P S RQRHRF L R+ QDPIRGG ATRP + EVEAY + +R RG Sbjct: 610 ERLDPPGSLRQRHRFRLERRLNQDPIRGGQGPATRPTQQEVEAYTKGQRFRG 661 >gb|EME82997.1| hypothetical protein MYCFIDRAFT_215158 [Pseudocercospora fijiensis CIRAD86] Length = 754 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = +2 Query: 2 ELLDEPQSTRQRHRFTLVRQAGQDPIRGGDNAATRPNKFEVEAYKEDKRLRGF 160 E +D S RQRHRFTL R+ GQDPIR A RP + E++AYK+DK LRG+ Sbjct: 699 EHIDAADSKRQRHRFTLQRKPGQDPIR-SSGPAKRPTQQELDAYKKDKTLRGY 750