BLASTX nr result
ID: Cocculus23_contig00060804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00060804 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44351.1| hypothetical protein DOTSEDRAFT_71999 [Dothistrom... 74 2e-11 gb|EMC97736.1| hypothetical protein BAUCODRAFT_122162 [Baudoinia... 59 9e-07 >gb|EME44351.1| hypothetical protein DOTSEDRAFT_71999 [Dothistroma septosporum NZE10] Length = 743 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/79 (40%), Positives = 51/79 (64%) Frame = +3 Query: 66 ERWKMILGREFKPFLDDELLADRKQCATVLLAYNKAGQAKSTTSKDEKERFFKELVDPSK 245 +R KM+ G+ ++ F+DDEL+ DR+ C + +YN+A A ST S EK R F+ ++DP Sbjct: 498 DRTKMLTGQPYRHFIDDELIRDRQSCRRAVESYNQACAASSTASDVEKVRHFQSIIDPRA 557 Query: 246 RPCWNGLSEAWRGPKGECG 302 R + + +W+GP+G CG Sbjct: 558 RTFSDTMVSSWQGPQGSCG 576 >gb|EMC97736.1| hypothetical protein BAUCODRAFT_122162 [Baudoinia compniacensis UAMH 10762] Length = 756 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 5/93 (5%) Frame = +3 Query: 39 LDRWARYRC-ERWKMILGREFKPFLDDELLADRKQCATVLLAYNKAGQAKSTTSKDEKER 215 L R +YR E+ KM+LG F ++D +L++DRK+C + YN A +A + ++ R Sbjct: 542 LARRDKYRLSEKEKMLLGEPFLAYVDRDLVSDRKECKAAVERYNDAAKASLGSGHGDRAR 601 Query: 216 FFKELVDPSKRPCWNGL----SEAWRGPKGECG 302 F +VDP+ RP + + GPKG G Sbjct: 602 LFNHIVDPTARPEERSRRRHPDDPYNGPKGSAG 634