BLASTX nr result
ID: Cocculus23_contig00060659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00060659 (217 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002582787.1| glutaredoxin [Uncinocarpus reesii 1704] gi|2... 91 2e-16 gb|EME48513.1| hypothetical protein DOTSEDRAFT_67524 [Dothistrom... 90 3e-16 ref|XP_003852675.1| putative P450 monooxygenase [Zymoseptoria tr... 90 4e-16 ref|XP_001244264.1| predicted protein [Coccidioides immitis RS] ... 90 4e-16 gb|EME88989.1| hypothetical protein MYCFIDRAFT_55506 [Pseudocerc... 89 8e-16 gb|EOA90261.1| hypothetical protein SETTUDRAFT_158864 [Setosphae... 88 1e-15 gb|EXJ95901.1| glutaredoxin 3 [Capronia coronata CBS 617.96] 88 1e-15 gb|EGD97830.1| glutaredoxin [Trichophyton tonsurans CBS 112818] ... 86 4e-15 ref|XP_003022176.1| hypothetical protein TRV_03700 [Trichophyton... 86 4e-15 ref|XP_007579629.1| putative glutaredoxin protein [Neofusicoccum... 86 5e-15 ref|XP_003016299.1| hypothetical protein ARB_05698 [Arthroderma ... 86 5e-15 gb|EXJ73061.1| glutaredoxin 3 [Cladophialophora psammophila CBS ... 86 7e-15 gb|EUN31078.1| hypothetical protein COCVIDRAFT_88740, partial [B... 86 7e-15 gb|EUC49386.1| hypothetical protein COCMIDRAFT_84672 [Bipolaris ... 86 7e-15 gb|EUC33727.1| hypothetical protein COCCADRAFT_95228, partial [B... 86 7e-15 gb|EMD60400.1| hypothetical protein COCSADRAFT_40040 [Bipolaris ... 86 7e-15 ref|XP_003238555.1| glutaredoxin [Trichophyton rubrum CBS 118892... 86 7e-15 ref|XP_003299699.1| hypothetical protein PTT_10750 [Pyrenophora ... 85 9e-15 ref|XP_003176912.1| glutaredoxin [Arthroderma gypseum CBS 118893... 85 1e-14 dbj|GAD96479.1| glutaredoxin Grx1, putative [Byssochlamys specta... 84 2e-14 >ref|XP_002582787.1| glutaredoxin [Uncinocarpus reesii 1704] gi|237908294|gb|EEP82695.1| glutaredoxin [Uncinocarpus reesii 1704] Length = 104 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDG+AIQ ALEE+T QRTVPNVFI+HKHIGGNSD+QA+KG+LP LLK A AL Sbjct: 49 QVDDGAAIQAALEELTSQRTVPNVFIDHKHIGGNSDLQARKGELPGLLKAAGAL 102 >gb|EME48513.1| hypothetical protein DOTSEDRAFT_67524 [Dothistroma septosporum NZE10] Length = 101 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDG+AIQ ALEEIT QR+VPNVFINHKHIGGNS++QAKK QLP LLK+A A+ Sbjct: 48 QVDDGAAIQDALEEITNQRSVPNVFINHKHIGGNSELQAKKSQLPDLLKKAGAV 101 >ref|XP_003852675.1| putative P450 monooxygenase [Zymoseptoria tritici IPO323] gi|339472556|gb|EGP87651.1| putative P450 monooxygenase [Zymoseptoria tritici IPO323] Length = 101 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDG+AIQ ALEEIT QR+VPN+FIN KHIGGNS++Q+KK QLP LLKEANA+ Sbjct: 48 QVDDGAAIQDALEEITSQRSVPNIFINKKHIGGNSELQSKKSQLPNLLKEANAI 101 >ref|XP_001244264.1| predicted protein [Coccidioides immitis RS] gi|303317104|ref|XP_003068554.1| glutaredoxin, putative [Coccidioides posadasii C735 delta SOWgp] gi|240108235|gb|EER26409.1| glutaredoxin, putative [Coccidioides posadasii C735 delta SOWgp] gi|320038461|gb|EFW20397.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|392870982|gb|EJB12099.1| glutaredoxin [Coccidioides immitis RS] Length = 104 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDG+AIQ ALEEIT QRTVPN+FI+HKHIGGNSD+QA+K +LP LLK A AL Sbjct: 49 QVDDGAAIQAALEEITNQRTVPNIFIDHKHIGGNSDLQARKSELPALLKAAGAL 102 >gb|EME88989.1| hypothetical protein MYCFIDRAFT_55506 [Pseudocercospora fijiensis CIRAD86] Length = 101 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDG+AIQ ALEEIT QR+VPN+FI+HKHIGGNSD+Q KK QLP LLK+A A+ Sbjct: 48 QVDDGAAIQDALEEITSQRSVPNIFIDHKHIGGNSDLQGKKSQLPELLKQAGAI 101 >gb|EOA90261.1| hypothetical protein SETTUDRAFT_158864 [Setosphaeria turcica Et28A] Length = 134 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDGSAIQ AL EITGQ TVPN+FI KHIGGNSD+QAKKGQL TLLK+A AL Sbjct: 81 QVDDGSAIQAALGEITGQTTVPNIFIAQKHIGGNSDLQAKKGQLNTLLKDAGAL 134 >gb|EXJ95901.1| glutaredoxin 3 [Capronia coronata CBS 617.96] Length = 102 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 +VDDG AIQ ALEEITGQRTVPN+FI HKHIGGNSD+QAKKGQL LLK A+ Sbjct: 49 EVDDGPAIQDALEEITGQRTVPNIFIGHKHIGGNSDLQAKKGQLDGLLKTVGAI 102 >gb|EGD97830.1| glutaredoxin [Trichophyton tonsurans CBS 112818] gi|326478335|gb|EGE02345.1| glutaredoxin Grx1 [Trichophyton equinum CBS 127.97] gi|607893664|gb|EZF32730.1| glutaredoxin [Trichophyton interdigitale H6] Length = 102 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 +VDDG AIQ AL+EIT QRTVPN+FIN +HIGGNSD+ AK GQLP LLKEA AL Sbjct: 49 KVDDGPAIQDALQEITSQRTVPNIFINQQHIGGNSDLHAKSGQLPALLKEAGAL 102 >ref|XP_003022176.1| hypothetical protein TRV_03700 [Trichophyton verrucosum HKI 0517] gi|291186110|gb|EFE41558.1| hypothetical protein TRV_03700 [Trichophyton verrucosum HKI 0517] Length = 60 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = -3 Query: 212 VDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 +DDG AIQ AL+EIT QRTVPN+FINH+HIGGNSD+ AK GQL TLLKEA AL Sbjct: 8 IDDGPAIQDALQEITNQRTVPNIFINHQHIGGNSDLVAKAGQLSTLLKEAGAL 60 >ref|XP_007579629.1| putative glutaredoxin protein [Neofusicoccum parvum UCRNP2] gi|485929536|gb|EOD52910.1| putative glutaredoxin protein [Neofusicoccum parvum UCRNP2] Length = 102 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDG+AIQ ALEEITGQR+VPN+FI+ KHIGGNSD+Q+KK +LP LLK A A+ Sbjct: 49 QVDDGAAIQDALEEITGQRSVPNIFIDKKHIGGNSDLQSKKSELPNLLKAAKAI 102 >ref|XP_003016299.1| hypothetical protein ARB_05698 [Arthroderma benhamiae CBS 112371] gi|291179868|gb|EFE35654.1| hypothetical protein ARB_05698 [Arthroderma benhamiae CBS 112371] Length = 60 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -3 Query: 212 VDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 +DDG AIQ AL+EIT QRTVPN+FINHKHIGGNSD+ AK GQL LLKEA AL Sbjct: 8 IDDGPAIQDALQEITNQRTVPNIFINHKHIGGNSDLVAKAGQLSALLKEAGAL 60 >gb|EXJ73061.1| glutaredoxin 3 [Cladophialophora psammophila CBS 110553] Length = 102 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 +VDDG+AIQ ALEEITGQR+VPN+FI+HKHIGGNSD+QA++GQL LL A AL Sbjct: 49 EVDDGAAIQDALEEITGQRSVPNIFIDHKHIGGNSDLQARRGQLNKLLSAAGAL 102 >gb|EUN31078.1| hypothetical protein COCVIDRAFT_88740, partial [Bipolaris victoriae FI3] Length = 137 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDGSAIQ L +ITGQRTVPN+FI +HIGGNSD+QAKKG+L TLLK+A AL Sbjct: 84 QVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGELNTLLKDAGAL 137 >gb|EUC49386.1| hypothetical protein COCMIDRAFT_84672 [Bipolaris oryzae ATCC 44560] Length = 138 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDGSAIQ L +ITGQRTVPN+FI +HIGGNSD+QAKKG+L TLLK+A AL Sbjct: 85 QVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGELNTLLKDAGAL 138 >gb|EUC33727.1| hypothetical protein COCCADRAFT_95228, partial [Bipolaris zeicola 26-R-13] Length = 137 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDGSAIQ L +ITGQRTVPN+FI +HIGGNSD+QAKKG+L TLLK+A AL Sbjct: 84 QVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGELNTLLKDAGAL 137 >gb|EMD60400.1| hypothetical protein COCSADRAFT_40040 [Bipolaris sorokiniana ND90Pr] Length = 102 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDGSAIQ L +ITGQRTVPN+FI +HIGGNSD+QAKKG+L TLLK+A AL Sbjct: 49 QVDDGSAIQSVLADITGQRTVPNIFIAQQHIGGNSDLQAKKGELNTLLKDAGAL 102 >ref|XP_003238555.1| glutaredoxin [Trichophyton rubrum CBS 118892] gi|326458811|gb|EGD84264.1| glutaredoxin [Trichophyton rubrum CBS 118892] gi|607865315|gb|EZF10735.1| glutaredoxin [Trichophyton rubrum MR850] gi|607899896|gb|EZF37632.1| glutaredoxin [Trichophyton rubrum CBS 100081] gi|607912058|gb|EZF48311.1| glutaredoxin [Trichophyton rubrum CBS 288.86] gi|607924097|gb|EZF58901.1| glutaredoxin [Trichophyton rubrum CBS 289.86] gi|607935988|gb|EZF69500.1| glutaredoxin [Trichophyton soudanense CBS 452.61] gi|607948018|gb|EZF80189.1| glutaredoxin [Trichophyton rubrum MR1448] gi|607960147|gb|EZF90850.1| glutaredoxin [Trichophyton rubrum MR1459] gi|607972446|gb|EZG01767.1| glutaredoxin [Trichophyton rubrum CBS 735.88] gi|607984133|gb|EZG12416.1| glutaredoxin [Trichophyton rubrum CBS 202.88] Length = 102 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 +VDDG AIQ AL+EIT QRTVPN+FINH+HIGGNSD+ AK GQL LLKEA AL Sbjct: 49 KVDDGPAIQDALQEITNQRTVPNIFINHQHIGGNSDLAAKAGQLSALLKEAGAL 102 >ref|XP_003299699.1| hypothetical protein PTT_10750 [Pyrenophora teres f. teres 0-1] gi|311326524|gb|EFQ92211.1| hypothetical protein PTT_10750 [Pyrenophora teres f. teres 0-1] Length = 102 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 QVDDGSA+Q L ++TGQ TVPN+FI KHIGGNSD+QAKKG+LP LLKEA AL Sbjct: 49 QVDDGSAMQSVLGDLTGQTTVPNIFIAQKHIGGNSDLQAKKGELPNLLKEAGAL 102 >ref|XP_003176912.1| glutaredoxin [Arthroderma gypseum CBS 118893] gi|311338758|gb|EFQ97960.1| glutaredoxin [Arthroderma gypseum CBS 118893] Length = 102 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 +VDDGSAIQ AL+EIT QRTVPN+FINH+HIGGNSD+ A+ GQL LLK+A A+ Sbjct: 49 KVDDGSAIQSALQEITNQRTVPNIFINHQHIGGNSDLVARSGQLTALLKDAGAI 102 >dbj|GAD96479.1| glutaredoxin Grx1, putative [Byssochlamys spectabilis No. 5] Length = 103 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/54 (70%), Positives = 48/54 (88%) Frame = -3 Query: 215 QVDDGSAIQGALEEITGQRTVPNVFINHKHIGGNSDVQAKKGQLPTLLKEANAL 54 Q+DDG+AIQ ALEE+TGQR+VPN+FIN +HIGGNSD+Q++K +LP LLK A AL Sbjct: 50 QIDDGAAIQDALEEVTGQRSVPNIFINKQHIGGNSDLQSRKAELPELLKGAGAL 103