BLASTX nr result
ID: Cocculus23_contig00060321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00060321 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME46547.1| hypothetical protein DOTSEDRAFT_22597 [Dothistrom... 75 1e-11 >gb|EME46547.1| hypothetical protein DOTSEDRAFT_22597 [Dothistroma septosporum NZE10] Length = 74 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/56 (55%), Positives = 44/56 (78%) Frame = -3 Query: 291 SILSGEVKEDPNHRMWAPARWVVQLVQYMIAIIVVTIAEGFKSILSGEGPKRRRQR 124 + + G DP ++MW PARW+ Q+VQY++AI+V+TIAEGFK+I+SGE PK RR + Sbjct: 14 AFIRGASNVDPENKMWWPARWIAQMVQYLVAIVVLTIAEGFKAIVSGEKPKGRRNK 69