BLASTX nr result
ID: Cocculus23_contig00060030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00060030 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC35480.1| putative glycosyltransferase [Morus notabilis] 59 5e-07 >gb|EXC35480.1| putative glycosyltransferase [Morus notabilis] Length = 553 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = +3 Query: 6 MVGMNLEMEEVQRLASIVGCLVGEWLLKYSSLPLGDNLSKEDFRAPVLDK 155 + G+N+E++ V+ +A+IVGC +GEWLL Y LPLG N ++F PVLDK Sbjct: 231 VAGINIEVQVVRDIAAIVGCGIGEWLLNYLGLPLGGNPLSKEFWTPVLDK 280