BLASTX nr result
ID: Cocculus23_contig00059377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059377 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003857577.1| hypothetical protein MYCGRDRAFT_65481 [Zymos... 65 7e-09 gb|EME83033.1| hypothetical protein MYCFIDRAFT_211227 [Pseudocer... 65 1e-08 gb|EON69526.1| hypothetical protein W97_08786 [Coniosporium apol... 64 3e-08 gb|EMF14036.1| hypothetical protein SEPMUDRAFT_147884 [Sphaeruli... 63 4e-08 gb|EME46554.1| hypothetical protein DOTSEDRAFT_70535 [Dothistrom... 62 8e-08 ref|XP_007584739.1| putative msf1 domain protein [Neofusicoccum ... 60 4e-07 gb|EKG11977.1| PRELI/MSF1 domain-containing protein [Macrophomin... 60 4e-07 gb|EUC43024.1| hypothetical protein COCMIDRAFT_102017 [Bipolaris... 59 9e-07 gb|EUC31259.1| hypothetical protein COCCADRAFT_101731 [Bipolaris... 59 9e-07 gb|EMD86501.1| hypothetical protein COCHEDRAFT_1024124 [Bipolari... 59 9e-07 gb|EMD70210.1| hypothetical protein COCSADRAFT_32836 [Bipolaris ... 59 9e-07 ref|XP_001795868.1| hypothetical protein SNOG_05463 [Phaeosphaer... 59 9e-07 gb|EOA87865.1| hypothetical protein SETTUDRAFT_168690 [Setosphae... 58 1e-06 ref|XP_003297548.1| hypothetical protein PTT_07988 [Pyrenophora ... 58 1e-06 ref|XP_001932664.1| MSF1 domain containing protein [Pyrenophora ... 58 1e-06 ref|XP_003844753.1| similar to MSF1 domain containing protein [L... 57 2e-06 ref|XP_001594020.1| hypothetical protein SS1G_05448 [Sclerotinia... 56 6e-06 >ref|XP_003857577.1| hypothetical protein MYCGRDRAFT_65481 [Zymoseptoria tritici IPO323] gi|339477462|gb|EGP92553.1| hypothetical protein MYCGRDRAFT_65481 [Zymoseptoria tritici IPO323] Length = 246 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDREL 120 LQRTEKSQPKA KGM+VVL RLRNGGL VLEGMR DRE+ Sbjct: 205 LQRTEKSQPKAQKGMSVVLARLRNGGLEGVLEGMRADREV 244 >gb|EME83033.1| hypothetical protein MYCFIDRAFT_211227 [Pseudocercospora fijiensis CIRAD86] Length = 244 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDREL 120 LQRTEKSQPKA +GM+VVL+RLR GG+ AVLEGMR+DREL Sbjct: 203 LQRTEKSQPKARQGMSVVLDRLREGGVQAVLEGMRQDREL 242 >gb|EON69526.1| hypothetical protein W97_08786 [Coniosporium apollinis CBS 100218] Length = 288 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDREL 120 L+R E+SQP A KGM VVL+RLR GGLVAVLEGMRRDRE+ Sbjct: 220 LRRAERSQPNAKKGMKVVLQRLRQGGLVAVLEGMRRDREM 259 >gb|EMF14036.1| hypothetical protein SEPMUDRAFT_147884 [Sphaerulina musiva SO2202] Length = 242 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDREL 120 +QRTEKSQPKA KGM VVL RLR GG+ AV+EGMR+DREL Sbjct: 201 MQRTEKSQPKAQKGMYVVLARLREGGVQAVMEGMRKDREL 240 >gb|EME46554.1| hypothetical protein DOTSEDRAFT_70535 [Dothistroma septosporum NZE10] Length = 258 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDREL 120 LQR EKSQPKA KGMTVVL RL+ GG+ AVLEGMR DRE+ Sbjct: 217 LQRAEKSQPKAKKGMTVVLARLQKGGIQAVLEGMRDDREI 256 >ref|XP_007584739.1| putative msf1 domain protein [Neofusicoccum parvum UCRNP2] gi|485922249|gb|EOD47804.1| putative msf1 domain protein [Neofusicoccum parvum UCRNP2] Length = 273 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L+R EKSQP A +GM +VL+R+R GGLVAVLEGMR+DRE Sbjct: 213 LKRAEKSQPNAKEGMKIVLQRMRQGGLVAVLEGMRQDRE 251 >gb|EKG11977.1| PRELI/MSF1 domain-containing protein [Macrophomina phaseolina MS6] Length = 273 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L+R EKSQP A +GM +VL+R+R GGLVAVLEGMR+DRE Sbjct: 213 LKRAEKSQPNAKEGMKIVLQRMRQGGLVAVLEGMRQDRE 251 >gb|EUC43024.1| hypothetical protein COCMIDRAFT_102017 [Bipolaris oryzae ATCC 44560] Length = 279 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLV VLEGMRRDRE Sbjct: 223 LSRAQRSQPNAREGMKVVLERMREGGLVGVLEGMRRDRE 261 >gb|EUC31259.1| hypothetical protein COCCADRAFT_101731 [Bipolaris zeicola 26-R-13] gi|578495221|gb|EUN32604.1| hypothetical protein COCVIDRAFT_84803 [Bipolaris victoriae FI3] Length = 279 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLV VLEGMRRDRE Sbjct: 223 LSRAQRSQPNAREGMKVVLERMREGGLVGVLEGMRRDRE 261 >gb|EMD86501.1| hypothetical protein COCHEDRAFT_1024124 [Bipolaris maydis C5] gi|477589373|gb|ENI06450.1| hypothetical protein COCC4DRAFT_31667 [Bipolaris maydis ATCC 48331] Length = 279 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLV VLEGMRRDRE Sbjct: 223 LSRAQRSQPNAREGMKVVLERMREGGLVGVLEGMRRDRE 261 >gb|EMD70210.1| hypothetical protein COCSADRAFT_32836 [Bipolaris sorokiniana ND90Pr] Length = 279 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLV VLEGMRRDRE Sbjct: 223 LSRAQRSQPNAREGMKVVLERMREGGLVGVLEGMRRDRE 261 >ref|XP_001795868.1| hypothetical protein SNOG_05463 [Phaeosphaeria nodorum SN15] gi|111065407|gb|EAT86527.1| hypothetical protein SNOG_05463 [Phaeosphaeria nodorum SN15] Length = 283 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLVAVLEGMR+DRE Sbjct: 226 LTRAQRSQPNAREGMKVVLERMREGGLVAVLEGMRKDRE 264 >gb|EOA87865.1| hypothetical protein SETTUDRAFT_168690 [Setosphaeria turcica Et28A] Length = 279 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLV VLEGMRRDRE Sbjct: 223 LTRAQRSQPNAREGMKVVLERMREGGLVGVLEGMRRDRE 261 >ref|XP_003297548.1| hypothetical protein PTT_07988 [Pyrenophora teres f. teres 0-1] gi|311329707|gb|EFQ94348.1| hypothetical protein PTT_07988 [Pyrenophora teres f. teres 0-1] Length = 278 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLVAVLEGMR+DRE Sbjct: 222 LTRAQRSQPNAREGMKVVLERMREGGLVAVLEGMRQDRE 260 >ref|XP_001932664.1| MSF1 domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978228|gb|EDU44854.1| MSF1 domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 278 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLVAVLEGMR+DRE Sbjct: 222 LTRAQRSQPNAREGMKVVLERMREGGLVAVLEGMRQDRE 260 >ref|XP_003844753.1| similar to MSF1 domain containing protein [Leptosphaeria maculans JN3] gi|312221334|emb|CBY01274.1| similar to MSF1 domain containing protein [Leptosphaeria maculans JN3] Length = 278 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 LQRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDRE 117 L R ++SQP A +GM VVLER+R GGLVAVLEGMR+DRE Sbjct: 223 LTRAQRSQPNAREGMKVVLERMRAGGLVAVLEGMRQDRE 261 >ref|XP_001594020.1| hypothetical protein SS1G_05448 [Sclerotinia sclerotiorum 1980] gi|154703232|gb|EDO02971.1| hypothetical protein SS1G_05448 [Sclerotinia sclerotiorum 1980 UF-70] Length = 238 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 4 QRTEKSQPKAIKGMTVVLERLRNGGLVAVLEGMRRDREL 120 ++TE K+ +GM VVLER+RNGGLVAVL+GMRRDREL Sbjct: 193 RKTENQLGKSKEGMMVVLERMRNGGLVAVLDGMRRDREL 231