BLASTX nr result
ID: Cocculus23_contig00059255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059255 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003840347.1| similar to 40s ribosomal protein S7 [Leptosp... 95 9e-18 gb|EMD00762.1| hypothetical protein BAUCODRAFT_81510 [Baudoinia ... 91 2e-16 gb|EMF17305.1| ribosomal protein S7e [Sphaerulina musiva SO2202] 90 3e-16 ref|XP_001796181.1| hypothetical protein SNOG_05785 [Phaeosphaer... 89 6e-16 gb|EME87396.1| hypothetical protein MYCFIDRAFT_26563 [Pseudocerc... 88 1e-15 gb|EME48880.1| hypothetical protein DOTSEDRAFT_142353 [Dothistro... 88 1e-15 gb|EUN28541.1| hypothetical protein COCVIDRAFT_36532 [Bipolaris ... 87 2e-15 gb|EON63531.1| 40S ribosomal protein S7 [Coniosporium apollinis ... 87 2e-15 gb|EOA88506.1| hypothetical protein SETTUDRAFT_168379 [Setosphae... 87 2e-15 gb|EMD87418.1| hypothetical protein COCHEDRAFT_30893 [Bipolaris ... 87 2e-15 gb|EMD59383.1| hypothetical protein COCSADRAFT_175916 [Bipolaris... 87 2e-15 ref|XP_003300199.1| 40S ribosomal protein S7 [Pyrenophora teres ... 87 2e-15 ref|XP_001933889.1| 40S ribosomal protein S7 [Pyrenophora tritic... 87 2e-15 ref|XP_007581070.1| putative 40s ribosomal protein s7 protein [N... 87 2e-15 gb|ELR04361.1| 40S ribosomal protein S7 [Pseudogymnoascus destru... 86 5e-15 gb|EKG17116.1| Ribosomal protein S7e [Macrophomina phaseolina MS6] 86 7e-15 ref|XP_003853563.1| 40S ribosomal protein S7 [Zymoseptoria triti... 85 1e-14 gb|EQL02859.1| Ribosomal protein S7e [Ophiocordyceps sinensis CO18] 84 2e-14 emb|CCU80381.1| 40S ribosomal protein S7 [Blumeria graminis f. s... 84 3e-14 ref|XP_007591973.1| 40S ribosomal protein S7 [Colletotrichum fio... 82 6e-14 >ref|XP_003840347.1| similar to 40s ribosomal protein S7 [Leptosphaeria maculans JN3] gi|312216919|emb|CBX96868.1| similar to 40s ribosomal protein S7 [Leptosphaeria maculans JN3] Length = 211 Score = 95.1 bits (235), Expect = 9e-18 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAEY 163 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAEY Sbjct: 166 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAEY 211 >gb|EMD00762.1| hypothetical protein BAUCODRAFT_81510 [Baudoinia compniacensis UAMH 10762] Length = 202 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAEY 163 SKILK+VLDEKERGGVDY+LDTYSEVYKRLTGKGVNFEFPQSA +Y Sbjct: 157 SKILKIVLDEKERGGVDYKLDTYSEVYKRLTGKGVNFEFPQSATDY 202 >gb|EMF17305.1| ribosomal protein S7e [Sphaerulina musiva SO2202] Length = 202 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAEY 163 +K+LKV+LDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQ+ AEY Sbjct: 157 AKVLKVILDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQAPAEY 202 >ref|XP_001796181.1| hypothetical protein SNOG_05785 [Phaeosphaeria nodorum SN15] gi|160706779|gb|EAT86849.2| hypothetical protein SNOG_05785 [Phaeosphaeria nodorum SN15] Length = 202 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAA 169 SK+LKVVLDEKERGGVDYRLDTY+EVYKRLTGKGVNFEFPQSAA Sbjct: 156 SKVLKVVLDEKERGGVDYRLDTYTEVYKRLTGKGVNFEFPQSAA 199 >gb|EME87396.1| hypothetical protein MYCFIDRAFT_26563 [Pseudocercospora fijiensis CIRAD86] Length = 203 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAEY 163 SKILKV+LDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFP S A++ Sbjct: 157 SKILKVILDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPASQADF 202 >gb|EME48880.1| hypothetical protein DOTSEDRAFT_142353 [Dothistroma septosporum NZE10] Length = 202 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAE 166 +KILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQ+A E Sbjct: 157 AKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQTAHE 201 >gb|EUN28541.1| hypothetical protein COCVIDRAFT_36532 [Bipolaris victoriae FI3] Length = 207 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 175 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS Sbjct: 161 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 202 >gb|EON63531.1| 40S ribosomal protein S7 [Coniosporium apollinis CBS 100218] Length = 203 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/47 (89%), Positives = 46/47 (97%), Gaps = 1/47 (2%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSA-AEY 163 SK+LK+VLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS+ A+Y Sbjct: 157 SKVLKIVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSSVADY 203 >gb|EOA88506.1| hypothetical protein SETTUDRAFT_168379 [Setosphaeria turcica Et28A] Length = 203 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 175 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS Sbjct: 157 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 198 >gb|EMD87418.1| hypothetical protein COCHEDRAFT_30893 [Bipolaris maydis C5] Length = 203 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 175 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS Sbjct: 157 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 198 >gb|EMD59383.1| hypothetical protein COCSADRAFT_175916 [Bipolaris sorokiniana ND90Pr] gi|477589542|gb|ENI06618.1| hypothetical protein COCC4DRAFT_70867 [Bipolaris maydis ATCC 48331] gi|576919776|gb|EUC33944.1| hypothetical protein COCCADRAFT_36298 [Bipolaris zeicola 26-R-13] gi|576927052|gb|EUC40761.1| hypothetical protein COCMIDRAFT_40961 [Bipolaris oryzae ATCC 44560] Length = 207 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 175 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS Sbjct: 161 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 202 >ref|XP_003300199.1| 40S ribosomal protein S7 [Pyrenophora teres f. teres 0-1] gi|311325822|gb|EFQ91726.1| hypothetical protein PTT_11367 [Pyrenophora teres f. teres 0-1] Length = 245 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 175 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS Sbjct: 199 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 240 >ref|XP_001933889.1| 40S ribosomal protein S7 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979768|gb|EDU46394.1| 40S ribosomal protein S7 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 209 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 175 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS Sbjct: 163 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS 204 >ref|XP_007581070.1| putative 40s ribosomal protein s7 protein [Neofusicoccum parvum UCRNP2] gi|485927448|gb|EOD51457.1| putative 40s ribosomal protein s7 protein [Neofusicoccum parvum UCRNP2] Length = 202 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/47 (89%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS-AAEY 163 SKILK++LDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS +EY Sbjct: 156 SKILKIILDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSNVSEY 202 >gb|ELR04361.1| 40S ribosomal protein S7 [Pseudogymnoascus destructans 20631-21] Length = 202 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAA 169 SK+LKV+LDEKERGGVDYRLDTYSEVY+RLTG+GVNFEFPQS A Sbjct: 155 SKVLKVILDEKERGGVDYRLDTYSEVYRRLTGRGVNFEFPQSVA 198 >gb|EKG17116.1| Ribosomal protein S7e [Macrophomina phaseolina MS6] Length = 202 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/47 (85%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQ-SAAEY 163 SK+LK++LDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQ + +EY Sbjct: 156 SKVLKIILDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQTNVSEY 202 >ref|XP_003853563.1| 40S ribosomal protein S7 [Zymoseptoria tritici IPO323] gi|339473445|gb|EGP88539.1| hypothetical protein MYCGRDRAFT_104028 [Zymoseptoria tritici IPO323] Length = 201 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAE 166 +K+LKV+LDEKERGGVDYRLD+YSEVYKRLTGKGVNFEFPQS +E Sbjct: 157 TKVLKVLLDEKERGGVDYRLDSYSEVYKRLTGKGVNFEFPQSHSE 201 >gb|EQL02859.1| Ribosomal protein S7e [Ophiocordyceps sinensis CO18] Length = 203 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/47 (87%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSA-AEY 163 SK+LKVVLDEKERGGVDYRLDTYSEVY+RLTG+ VNFEFPQS+ AEY Sbjct: 157 SKLLKVVLDEKERGGVDYRLDTYSEVYRRLTGRNVNFEFPQSSGAEY 203 >emb|CCU80381.1| 40S ribosomal protein S7 [Blumeria graminis f. sp. hordei DH14] Length = 200 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/46 (78%), Positives = 45/46 (97%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAEY 163 SKI+KV+LDEKE+GGVD+RLDTYSEVY++LTG+GVNFEFPQ +A+Y Sbjct: 155 SKIMKVILDEKEKGGVDHRLDTYSEVYRKLTGRGVNFEFPQGSADY 200 >ref|XP_007591973.1| 40S ribosomal protein S7 [Colletotrichum fioriniae PJ7] gi|588904554|gb|EXF84465.1| 40S ribosomal protein S7 [Colletotrichum fioriniae PJ7] Length = 202 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/47 (82%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 300 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQS-AAEY 163 SK+LKV+LDEKERGGVDYRLDTYSEVY++LTG+GV FEFPQS +AEY Sbjct: 156 SKLLKVILDEKERGGVDYRLDTYSEVYRKLTGRGVTFEFPQSGSAEY 202