BLASTX nr result
ID: Cocculus23_contig00059195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059195 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006378242.1| hypothetical protein POPTR_0010s05690g [Popu... 91 2e-16 ref|XP_006378241.1| hypothetical protein POPTR_0010s05690g [Popu... 91 2e-16 ref|XP_007044812.1| Phototropic-responsive NPH3 family protein [... 90 3e-16 ref|XP_007221979.1| hypothetical protein PRUPE_ppa002809mg [Prun... 90 3e-16 ref|XP_003519715.1| PREDICTED: BTB/POZ domain-containing protein... 90 3e-16 ref|XP_002530034.1| signal transducer, putative [Ricinus communi... 90 3e-16 gb|EXB82543.1| BTB/POZ domain-containing protein [Morus notabilis] 90 4e-16 ref|XP_004299219.1| PREDICTED: BTB/POZ domain-containing protein... 90 4e-16 ref|XP_002282444.2| PREDICTED: BTB/POZ domain-containing protein... 89 5e-16 emb|CBI16786.3| unnamed protein product [Vitis vinifera] 89 5e-16 ref|XP_002311763.1| phototropic-responsive NPH3 family protein [... 89 5e-16 ref|XP_004172442.1| PREDICTED: BTB/POZ domain-containing protein... 89 6e-16 ref|XP_004135274.1| PREDICTED: BTB/POZ domain-containing protein... 89 6e-16 ref|XP_006483950.1| PREDICTED: BTB/POZ domain-containing protein... 88 1e-15 ref|XP_007158393.1| hypothetical protein PHAVU_002G149400g [Phas... 88 1e-15 ref|XP_006438255.1| hypothetical protein CICLE_v10030958mg [Citr... 88 1e-15 ref|XP_003613103.1| BTB/POZ domain-containing protein [Medicago ... 88 1e-15 emb|CAN63893.1| hypothetical protein VITISV_019664 [Vitis vinifera] 87 2e-15 ref|XP_004489774.1| PREDICTED: BTB/POZ domain-containing protein... 87 3e-15 ref|XP_007153783.1| hypothetical protein PHAVU_003G064600g [Phas... 86 5e-15 >ref|XP_006378242.1| hypothetical protein POPTR_0010s05690g [Populus trichocarpa] gi|566189268|ref|XP_002314595.2| hypothetical protein POPTR_0010s05690g [Populus trichocarpa] gi|550329154|gb|ERP56039.1| hypothetical protein POPTR_0010s05690g [Populus trichocarpa] gi|550329155|gb|EEF00766.2| hypothetical protein POPTR_0010s05690g [Populus trichocarpa] Length = 628 Score = 90.5 bits (223), Expect = 2e-16 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+EV+SDLIVQV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIVQVTGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_006378241.1| hypothetical protein POPTR_0010s05690g [Populus trichocarpa] gi|550329152|gb|ERP56038.1| hypothetical protein POPTR_0010s05690g [Populus trichocarpa] Length = 620 Score = 90.5 bits (223), Expect = 2e-16 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+EV+SDLIVQV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIVQVTGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_007044812.1| Phototropic-responsive NPH3 family protein [Theobroma cacao] gi|508708747|gb|EOY00644.1| Phototropic-responsive NPH3 family protein [Theobroma cacao] Length = 632 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_007221979.1| hypothetical protein PRUPE_ppa002809mg [Prunus persica] gi|462418915|gb|EMJ23178.1| hypothetical protein PRUPE_ppa002809mg [Prunus persica] Length = 631 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTTEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_003519715.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Glycine max] Length = 636 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_002530034.1| signal transducer, putative [Ricinus communis] gi|223530450|gb|EEF32334.1| signal transducer, putative [Ricinus communis] Length = 631 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQ 54 >gb|EXB82543.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 645 Score = 89.7 bits (221), Expect = 4e-16 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRS+S+EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTTEAVRSISSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_004299219.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Fragaria vesca subsp. vesca] Length = 631 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTSEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_002282444.2| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Vitis vinifera] Length = 630 Score = 89.4 bits (220), Expect = 5e-16 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+E++SDLIVQV GSRY+LHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTTEAVRSVSSEISSDLIVQVKGSRYMLHKFPLLSKCLRLQ 54 >emb|CBI16786.3| unnamed protein product [Vitis vinifera] Length = 472 Score = 89.4 bits (220), Expect = 5e-16 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+E++SDLIVQV GSRY+LHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTTEAVRSVSSEISSDLIVQVKGSRYMLHKFPLLSKCLRLQ 54 >ref|XP_002311763.1| phototropic-responsive NPH3 family protein [Populus trichocarpa] gi|222851583|gb|EEE89130.1| phototropic-responsive NPH3 family protein [Populus trichocarpa] Length = 628 Score = 89.4 bits (220), Expect = 5e-16 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT +AVRSVS+EV+SDLIVQV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAQAVRSVSSEVSSDLIVQVKGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_004172442.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis sativus] Length = 627 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSV++EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVTSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_004135274.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis sativus] Length = 627 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSV++EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVTSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQ 54 >ref|XP_006483950.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform X1 [Citrus sinensis] gi|568860901|ref|XP_006483951.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform X2 [Citrus sinensis] gi|568860903|ref|XP_006483952.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform X3 [Citrus sinensis] Length = 629 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRS+S+EV+SDLI+QV G+RYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTSEAVRSISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQ 54 >ref|XP_007158393.1| hypothetical protein PHAVU_002G149400g [Phaseolus vulgaris] gi|561031808|gb|ESW30387.1| hypothetical protein PHAVU_002G149400g [Phaseolus vulgaris] Length = 632 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+EV+SDL++QV GS+YLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLLIQVKGSKYLLHKFPLLSKCLRLQ 54 >ref|XP_006438255.1| hypothetical protein CICLE_v10030958mg [Citrus clementina] gi|567891471|ref|XP_006438256.1| hypothetical protein CICLE_v10030958mg [Citrus clementina] gi|567891473|ref|XP_006438257.1| hypothetical protein CICLE_v10030958mg [Citrus clementina] gi|557540451|gb|ESR51495.1| hypothetical protein CICLE_v10030958mg [Citrus clementina] gi|557540452|gb|ESR51496.1| hypothetical protein CICLE_v10030958mg [Citrus clementina] gi|557540453|gb|ESR51497.1| hypothetical protein CICLE_v10030958mg [Citrus clementina] Length = 629 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRS+S+EV+SDLI+QV G+RYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTSEAVRSISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQ 54 >ref|XP_003613103.1| BTB/POZ domain-containing protein [Medicago truncatula] gi|355514438|gb|AES96061.1| BTB/POZ domain-containing protein [Medicago truncatula] Length = 636 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EA+R++S+EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTSEAIRTISSEVSSDLIIQVRGSRYLLHKFPLLSKCLCLQ 54 >emb|CAN63893.1| hypothetical protein VITISV_019664 [Vitis vinifera] Length = 619 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT EAVRSVS+E++SDLIVQV GSRY+LHK P LSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTTEAVRSVSSEISSDLIVQVKGSRYMLHKFPXLSKCLRLQ 54 >ref|XP_004489774.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cicer arietinum] Length = 638 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT E VR++S+EV+SDLI+QV GSRYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTSETVRTISSEVSSDLIIQVKGSRYLLHKFPLLSKCLCLQ 54 >ref|XP_007153783.1| hypothetical protein PHAVU_003G064600g [Phaseolus vulgaris] gi|561027137|gb|ESW25777.1| hypothetical protein PHAVU_003G064600g [Phaseolus vulgaris] Length = 632 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = +3 Query: 102 MKFMKLGYCPDTFYTIEAVRSVSTEVTSDLIVQVNGSRYLLHKAPLLSKCLYLQ 263 MKFMKLG PDTFYT E++R++S+EV+SDLI+QV G+RYLLHK PLLSKCL LQ Sbjct: 1 MKFMKLGSRPDTFYTAESIRTISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQ 54