BLASTX nr result
ID: Cocculus23_contig00057447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00057447 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC96525.1| thioredoxin 1 [Scylla paramamosain] 114 1e-23 gb|ABM55528.1| thioredoxin-like protein [Maconellicoccus hirsutus] 113 3e-23 gb|ABD98743.1| thioredoxin-like protein [Graphocephala atropunct... 110 2e-22 ref|XP_003250408.1| PREDICTED: thioredoxin-2 isoform 1 [Apis mel... 110 2e-22 gb|AGF33352.1| thioredoxin [Apis cerana] 110 3e-22 ref|XP_001602650.2| PREDICTED: thioredoxin-2-like [Nasonia vitri... 109 4e-22 ref|XP_006608786.1| PREDICTED: thioredoxin-2-like [Apis dorsata] 108 6e-22 gb|AFU83101.1| thioredoxin 2 [Apis cerana cerana] gi|408717375|g... 108 6e-22 gb|EZA49305.1| Thioredoxin-2 [Cerapachys biroi] 108 8e-22 gb|ACQ59118.1| Trx1 [Eriocheir sinensis] 108 8e-22 gb|EGI64147.1| Thioredoxin-2 [Acromyrmex echinatior] 108 1e-21 gb|EFN85525.1| Thioredoxin-2 [Harpegnathos saltator] 107 1e-21 ref|XP_003396074.1| PREDICTED: thioredoxin-2-like [Bombus terres... 107 2e-21 gb|AFE88625.1| thioredoxin 1 [Portunus trituberculatus] gi|38085... 106 3e-21 ref|XP_003490398.1| PREDICTED: thioredoxin-2-like [Bombus impati... 106 3e-21 pdb|3ZZX|A Chain A, Crystallographic Structure Of Thioredoxin Fr... 106 4e-21 gb|ADV36299.1| thioredoxin [Penaeus monodon] gi|336171137|gb|AEI... 106 4e-21 gb|ACA60746.1| thioredoxin 1 [Litopenaeus vannamei] 106 4e-21 gb|AFZ78678.1| thioredoxin-like protein [Coptotermes formosanus] 105 8e-21 gb|ACX30746.1| thioredoxin [Fenneropenaeus chinensis] 103 2e-20 >gb|AGC96525.1| thioredoxin 1 [Scylla paramamosain] Length = 105 Score = 114 bits (286), Expect = 1e-23 Identities = 52/81 (64%), Positives = 67/81 (82%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L EAG KLVV+DFYA WCGPCK+ISPK++EMSE+M DVVFLKVDVD SE ++ ++S M Sbjct: 15 LKEAGQKLVVVDFYATWCGPCKMISPKIQEMSEQMSDVVFLKVDVDESEEVAMAYQVSCM 74 Query: 217 RTFFFIKEKKELENFSGANSE 155 TF FIKE K++++FSGA+ + Sbjct: 75 PTFIFIKEGKKVDSFSGASED 95 >gb|ABM55528.1| thioredoxin-like protein [Maconellicoccus hirsutus] Length = 107 Score = 113 bits (282), Expect = 3e-23 Identities = 53/81 (65%), Positives = 67/81 (82%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L+EAG+KLVVIDF+AAWCGPCK ISPK+EE+S DVVFLK+DVD E ++E ISSM Sbjct: 15 LSEAGSKLVVIDFFAAWCGPCKFISPKLEELSTVETDVVFLKIDVDECEDLAEAYEISSM 74 Query: 217 RTFFFIKEKKELENFSGANSE 155 TF FIK KK++++FSGAN++ Sbjct: 75 PTFIFIKNKKKVDSFSGANAD 95 >gb|ABD98743.1| thioredoxin-like protein [Graphocephala atropunctata] Length = 105 Score = 110 bits (276), Expect = 2e-22 Identities = 53/81 (65%), Positives = 62/81 (76%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L EAG LVVIDF+A WCGPCKLI+P +E M EE DV+FLKVDVD E I+ + ISSM Sbjct: 15 LKEAGNNLVVIDFFATWCGPCKLIAPHIETMDEEFPDVMFLKVDVDECEGIAAQYEISSM 74 Query: 217 RTFFFIKEKKELENFSGANSE 155 TF FIK K+LENF+GAN+E Sbjct: 75 PTFVFIKNSKQLENFAGANAE 95 >ref|XP_003250408.1| PREDICTED: thioredoxin-2 isoform 1 [Apis mellifera] Length = 105 Score = 110 bits (275), Expect = 2e-22 Identities = 53/79 (67%), Positives = 62/79 (78%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AG +LVVIDF+A WCGPCK+I PKVEE+S EM DV+FLKVDVD E I+ + I+SM Sbjct: 15 LEKAGNQLVVIDFFAMWCGPCKMIGPKVEELSMEMEDVIFLKVDVDECEDIAGEYEITSM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIK K LENFSGAN Sbjct: 75 PTFVFIKNNKVLENFSGAN 93 >gb|AGF33352.1| thioredoxin [Apis cerana] Length = 105 Score = 110 bits (274), Expect = 3e-22 Identities = 53/79 (67%), Positives = 62/79 (78%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AG +LVVIDF+A WCGPCK+I PKVEE+S EM DV+FLKVDVD E I+ + I+SM Sbjct: 15 LEKAGDQLVVIDFFAMWCGPCKMIGPKVEELSMEMEDVIFLKVDVDECEDIAGEYEITSM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIK K LENFSGAN Sbjct: 75 PTFVFIKNNKVLENFSGAN 93 >ref|XP_001602650.2| PREDICTED: thioredoxin-2-like [Nasonia vitripennis] Length = 116 Score = 109 bits (272), Expect = 4e-22 Identities = 51/81 (62%), Positives = 65/81 (80%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 LTEAG KLVVIDF+A WCGPCK+I+PK++E+S+E+ DVVFLKVDVD E ++E+ ++SM Sbjct: 26 LTEAGEKLVVIDFFATWCGPCKMIAPKLDELSQELTDVVFLKVDVDELEGVAEEYDVNSM 85 Query: 217 RTFFFIKEKKELENFSGANSE 155 TF FIK L+ FSGAN E Sbjct: 86 PTFVFIKNGSVLDKFSGANIE 106 >ref|XP_006608786.1| PREDICTED: thioredoxin-2-like [Apis dorsata] Length = 105 Score = 108 bits (271), Expect = 6e-22 Identities = 53/79 (67%), Positives = 61/79 (77%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AG +LVVIDF+A WCGPCK+I PKVEE+S EM DV+FLKVDVD E I + I+SM Sbjct: 15 LEKAGDQLVVIDFFAVWCGPCKIIGPKVEELSLEMEDVIFLKVDVDECEDIVGEYEITSM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIK K LENFSGAN Sbjct: 75 PTFVFIKNSKVLENFSGAN 93 >gb|AFU83101.1| thioredoxin 2 [Apis cerana cerana] gi|408717375|gb|AFU83102.1| thioredoxin 2 [Apis cerana cerana] Length = 105 Score = 108 bits (271), Expect = 6e-22 Identities = 53/79 (67%), Positives = 61/79 (77%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AG +LVVIDF+A WCGPCK+I PKVEE+S EM DV FLKVDVD E I+ + I+SM Sbjct: 15 LEKAGDQLVVIDFFAMWCGPCKMIGPKVEELSMEMEDVTFLKVDVDECEDIAGEYEITSM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIK K LENFSGAN Sbjct: 75 PTFVFIKNNKVLENFSGAN 93 >gb|EZA49305.1| Thioredoxin-2 [Cerapachys biroi] Length = 105 Score = 108 bits (270), Expect = 8e-22 Identities = 50/79 (63%), Positives = 63/79 (79%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AGT LVVIDF+A WCGPCK+I PK+EE+S+E+ DVVFLK+DVD E ++ + I+SM Sbjct: 15 LEKAGTNLVVIDFFAVWCGPCKIIGPKIEELSKELQDVVFLKIDVDECEDLAAEYDIASM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIKE K LE F+GAN Sbjct: 75 PTFVFIKEGKVLETFAGAN 93 >gb|ACQ59118.1| Trx1 [Eriocheir sinensis] Length = 105 Score = 108 bits (270), Expect = 8e-22 Identities = 49/81 (60%), Positives = 65/81 (80%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L EAG KLVV+DFYA WCGPCK+I+PK++EMS +M DVVFLKVDVD E ++ +IS M Sbjct: 15 LKEAGQKLVVVDFYATWCGPCKMIAPKLQEMSSQMTDVVFLKVDVDECEDVAVTYQISCM 74 Query: 217 RTFFFIKEKKELENFSGANSE 155 TF F KE++++++FSGA+ E Sbjct: 75 PTFLFFKEEQKIDSFSGASEE 95 >gb|EGI64147.1| Thioredoxin-2 [Acromyrmex echinatior] Length = 110 Score = 108 bits (269), Expect = 1e-21 Identities = 53/79 (67%), Positives = 61/79 (77%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AG LVVIDF+A WCGPCK+I P +EE+S+EM DVVFLKVDVD E I+ + ISSM Sbjct: 20 LKDAGNNLVVIDFFAVWCGPCKMIGPLIEELSKEMLDVVFLKVDVDECEDIAVEYEISSM 79 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIKE K LE FSGAN Sbjct: 80 PTFVFIKEGKVLETFSGAN 98 >gb|EFN85525.1| Thioredoxin-2 [Harpegnathos saltator] Length = 108 Score = 107 bits (268), Expect = 1e-21 Identities = 50/79 (63%), Positives = 63/79 (79%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AG KLVVIDF+A WCGPCK+I PKV E+++EM DV+FLKVDVD E ++ + +ISSM Sbjct: 18 LEKAGDKLVVIDFFAIWCGPCKMIGPKVAELAKEMEDVIFLKVDVDECEDVAAQYQISSM 77 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIK K LE+F+GAN Sbjct: 78 PTFVFIKNSKVLESFAGAN 96 >ref|XP_003396074.1| PREDICTED: thioredoxin-2-like [Bombus terrestris] Length = 105 Score = 107 bits (266), Expect = 2e-21 Identities = 50/79 (63%), Positives = 62/79 (78%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AG LVV+DF+A WCGPCK+I+PK+EE+S+EM +V+FLKVDVD E I+ + ISSM Sbjct: 15 LEKAGDNLVVVDFFATWCGPCKMIAPKLEELSKEMENVIFLKVDVDECEDIASEYGISSM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIK K LE FSGAN Sbjct: 75 PTFVFIKNSKVLETFSGAN 93 >gb|AFE88625.1| thioredoxin 1 [Portunus trituberculatus] gi|380855526|gb|AFE88626.1| thioredoxin 1 [Portunus trituberculatus] Length = 105 Score = 106 bits (265), Expect = 3e-21 Identities = 46/81 (56%), Positives = 65/81 (80%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L AG KLVV+DFYA WCGPCK+I+PK++EMSE+M DVVFLKVDVD ++ ++ ++S M Sbjct: 15 LKNAGQKLVVVDFYATWCGPCKIIAPKIQEMSEQMSDVVFLKVDVDENDEVAVTYKVSCM 74 Query: 217 RTFFFIKEKKELENFSGANSE 155 TF F K +K++++FSGA+ + Sbjct: 75 PTFVFFKAEKKVDSFSGASED 95 >ref|XP_003490398.1| PREDICTED: thioredoxin-2-like [Bombus impatiens] Length = 105 Score = 106 bits (265), Expect = 3e-21 Identities = 49/79 (62%), Positives = 62/79 (78%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L +AG LVV+DF+A WCGPCK+I+P++EE+S+EM +V+FLKVDVD E I+ + ISSM Sbjct: 15 LEKAGDNLVVVDFFATWCGPCKMIAPRLEELSKEMENVIFLKVDVDECEDIASEYEISSM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF FIK K LE FSGAN Sbjct: 75 PTFVFIKNSKVLETFSGAN 93 >pdb|3ZZX|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei gi|406855549|pdb|3ZZX|B Chain B, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei gi|459358513|pdb|4AJ6|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei (reduced Form). gi|459358514|pdb|4AJ6|B Chain B, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei (reduced Form). gi|459358515|pdb|4AJ7|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei (oxidized Form). gi|459358516|pdb|4AJ7|B Chain B, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei (oxidized Form). gi|459358517|pdb|4AJ8|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei (partially Reduced). gi|459358518|pdb|4AJ8|B Chain B, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei (partially Reduced) Length = 105 Score = 106 bits (264), Expect = 4e-21 Identities = 49/79 (62%), Positives = 63/79 (79%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L EAG KLVVIDFYA WCGPCK+I+PK+EE+S+ M DVVFLKVDVD E I++ +I+ M Sbjct: 15 LNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF F+K ++L++ SGAN Sbjct: 75 PTFLFMKNGQKLDSLSGAN 93 >gb|ADV36299.1| thioredoxin [Penaeus monodon] gi|336171137|gb|AEI25985.1| thioredoxin [Penaeus monodon] Length = 105 Score = 106 bits (264), Expect = 4e-21 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L EAG KLVVIDFYA WCGPCK+I+PK+EE+S+ M DVVFLKVDVD E I++ +I+ M Sbjct: 15 LNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACM 74 Query: 217 RTFFFIKEKKELENFSGANSE 155 TF ++K ++L++ SGAN E Sbjct: 75 PTFLYMKNGQKLDSLSGANYE 95 >gb|ACA60746.1| thioredoxin 1 [Litopenaeus vannamei] Length = 105 Score = 106 bits (264), Expect = 4e-21 Identities = 49/79 (62%), Positives = 63/79 (79%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L EAG KLVVIDFYA WCGPCK+I+PK+EE+S+ M DVVFLKVDVD E I++ +I+ M Sbjct: 15 LNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF F+K ++L++ SGAN Sbjct: 75 PTFLFMKNGQKLDSLSGAN 93 >gb|AFZ78678.1| thioredoxin-like protein [Coptotermes formosanus] Length = 105 Score = 105 bits (261), Expect = 8e-21 Identities = 48/81 (59%), Positives = 65/81 (80%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 LTEAG+ LVVIDF+A WCGPCK+I+P++EE++ E DVVFLKVDVD E I+ I++M Sbjct: 15 LTEAGSSLVVIDFFAQWCGPCKVIAPRIEELAAEYPDVVFLKVDVDECEDIAADYEITAM 74 Query: 217 RTFFFIKEKKELENFSGANSE 155 TF FIK K++++ FSGAN++ Sbjct: 75 PTFVFIKNKQKVDAFSGANAD 95 >gb|ACX30746.1| thioredoxin [Fenneropenaeus chinensis] Length = 105 Score = 103 bits (258), Expect = 2e-20 Identities = 47/79 (59%), Positives = 63/79 (79%) Frame = -2 Query: 397 LTEAGTKLVVIDFYAAWCGPCKLISPKVEEMSEEMHDVVFLKVDVDASETISEKCRISSM 218 L EAG KLVVIDFYA WCGPCK+I+PK++E+S+ M DVVFLKVDVD E I++ +I+ M Sbjct: 15 LNEAGNKLVVIDFYATWCGPCKMIAPKLQELSQSMSDVVFLKVDVDECEDIAQDNQIACM 74 Query: 217 RTFFFIKEKKELENFSGAN 161 TF ++K ++L++ SGAN Sbjct: 75 PTFLYMKNGQKLDSLSGAN 93