BLASTX nr result
ID: Cocculus23_contig00057378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00057378 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208774.1| hypothetical protein PRUPE_ppa023623mg [Prun... 57 2e-06 >ref|XP_007208774.1| hypothetical protein PRUPE_ppa023623mg [Prunus persica] gi|462404509|gb|EMJ09973.1| hypothetical protein PRUPE_ppa023623mg [Prunus persica] Length = 485 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +2 Query: 137 IIATLCFIVLLIEVVQYXXXXXIRKGTLRLPPGRRGWPLVGDSLNWY 277 I TL FI L ++++ IR+ T +LPPGRRGWP+VGDS +WY Sbjct: 14 ISTTLLFICFLAKLIRRRNRVVIRRSTYKLPPGRRGWPIVGDSFSWY 60