BLASTX nr result
ID: Cocculus23_contig00057229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00057229 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK32318.1| NBS resistance protein, partial [Phyllostachys ni... 56 5e-06 >gb|AFK32318.1| NBS resistance protein, partial [Phyllostachys nigra] Length = 232 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = +3 Query: 12 LMCAGTGSKVLVTTRSDLDASIVD-APPTYKYDLGMLSEDDCWVVFERPAFQTG 170 L GSKV+VTTRS+ A ++ PP Y+LG+LS+DDCW++FE+ AF G Sbjct: 95 LKVGAKGSKVIVTTRSEKVARLMGPGPPGISYELGVLSDDDCWILFEQRAFLHG 148