BLASTX nr result
ID: Cocculus23_contig00057169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00057169 (217 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC96653.1| hypothetical protein BAUCODRAFT_34032 [Baudoinia ... 137 2e-30 gb|EOA90996.1| hypothetical protein SETTUDRAFT_102110 [Setosphae... 134 1e-29 gb|EMF16436.1| 40S ribosomal protein S6-B [Sphaerulina musiva SO... 134 2e-29 ref|XP_001935910.1| 40S ribosomal protein S6 [Pyrenophora tritic... 133 2e-29 ref|XP_003306964.1| 40S ribosomal protein S6 [Pyrenophora teres ... 133 3e-29 gb|EMD96068.1| hypothetical protein COCHEDRAFT_1166905 [Bipolari... 132 4e-29 gb|EME89012.1| hypothetical protein MYCFIDRAFT_181407 [Pseudocer... 132 6e-29 gb|EUC42499.1| hypothetical protein COCMIDRAFT_103365 [Bipolaris... 131 8e-29 gb|EME48945.1| hypothetical protein DOTSEDRAFT_67853 [Dothistrom... 131 8e-29 ref|XP_001797870.1| hypothetical protein SNOG_07535 [Phaeosphaer... 128 9e-28 gb|EON67752.1| 40S ribosomal protein S6-B [Coniosporium apollini... 127 1e-27 ref|XP_003836586.1| hypothetical protein LEMA_P041220.1 [Leptosp... 127 1e-27 gb|EHY57703.1| 40S ribosomal protein S6-A [Exophiala dermatitidi... 126 3e-27 ref|XP_003852989.1| 40S ribosomal protein S6 [Zymoseptoria triti... 126 4e-27 gb|ETI27818.1| 40S ribosomal protein S6-B [Cladophialophora carr... 125 5e-27 gb|EXJ95055.1| 40S ribosomal protein S6-A [Capronia coronata CBS... 125 6e-27 gb|EMD69198.1| hypothetical protein COCSADRAFT_186166 [Bipolaris... 125 6e-27 gb|EXJ88970.1| 40S ribosomal protein S6-B [Capronia epimyces CBS... 125 8e-27 ref|XP_002835429.1| 40S ribosomal protein S6 [Tuber melanosporum... 125 8e-27 gb|EXJ63909.1| 40S ribosomal protein S6-B [Cladophialophora yegr... 124 1e-26 >gb|EMC96653.1| hypothetical protein BAUCODRAFT_34032 [Baudoinia compniacensis UAMH 10762] Length = 239 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREVQPKKEGAK YTKAPRIQRLVTPQRLQHKRHRIA+KRRRAEASKDA Sbjct: 148 SKEDDVRKFVIRREVQPKKEGAKPYTKAPRIQRLVTPQRLQHKRHRIAIKRRRAEASKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++LHKR Sbjct: 208 ANEYAQILHKR 218 >gb|EOA90996.1| hypothetical protein SETTUDRAFT_102110 [Setosphaeria turcica Et28A] Length = 239 Score = 134 bits (338), Expect = 1e-29 Identities = 67/71 (94%), Positives = 69/71 (97%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREVQPKKEGAK YTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA Sbjct: 148 SKEDDVRKFVIRREVQPKKEGAKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQILSKR 218 >gb|EMF16436.1| 40S ribosomal protein S6-B [Sphaerulina musiva SO2202] Length = 241 Score = 134 bits (336), Expect = 2e-29 Identities = 68/73 (93%), Positives = 71/73 (97%), Gaps = 2/73 (2%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPK--KEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASK 42 SKEDDVRKFVIRREVQPK KEGAK+YTKAPRIQRLVTPQRLQHKRHR+ALKRRRAEASK Sbjct: 148 SKEDDVRKFVIRREVQPKEGKEGAKAYTKAPRIQRLVTPQRLQHKRHRVALKRRRAEASK 207 Query: 41 DAANEYAKVLHKR 3 DAANEYA+VLHKR Sbjct: 208 DAANEYAQVLHKR 220 >ref|XP_001935910.1| 40S ribosomal protein S6 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983009|gb|EDU48497.1| 40S ribosomal protein S6-B [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 239 Score = 133 bits (335), Expect = 2e-29 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREVQPKKEGAK YTKAP+IQRLVTPQRLQHKRHRIALKRRRAEASKDA Sbjct: 148 SKEDDVRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQILSKR 218 >ref|XP_003306964.1| 40S ribosomal protein S6 [Pyrenophora teres f. teres 0-1] gi|311315235|gb|EFQ84937.1| hypothetical protein PTT_20282 [Pyrenophora teres f. teres 0-1] Length = 239 Score = 133 bits (334), Expect = 3e-29 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREVQPKKEGAK YTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDA Sbjct: 148 SKEDDVRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRVALKRRRAEASKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQILSKR 218 >gb|EMD96068.1| hypothetical protein COCHEDRAFT_1166905 [Bipolaris maydis C5] gi|477593859|gb|ENI10928.1| hypothetical protein COCC4DRAFT_46559 [Bipolaris maydis ATCC 48331] gi|576924864|gb|EUC38971.1| hypothetical protein COCCADRAFT_21712 [Bipolaris zeicola 26-R-13] gi|578485559|gb|EUN23053.1| hypothetical protein COCVIDRAFT_109868 [Bipolaris victoriae FI3] Length = 239 Score = 132 bits (333), Expect = 4e-29 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREVQPKKEGAK YTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDA Sbjct: 148 SKEDDVRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRLALKRRRAEASKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQILSKR 218 >gb|EME89012.1| hypothetical protein MYCFIDRAFT_181407 [Pseudocercospora fijiensis CIRAD86] Length = 241 Score = 132 bits (331), Expect = 6e-29 Identities = 67/73 (91%), Positives = 70/73 (95%), Gaps = 2/73 (2%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPK--KEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASK 42 SKEDDVRKFVIRREVQPK KEGAK YTKAPRIQRLVTPQRLQHKRHRIALKRRRAEA+K Sbjct: 148 SKEDDVRKFVIRREVQPKEGKEGAKPYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEAAK 207 Query: 41 DAANEYAKVLHKR 3 DAANEYA++LHKR Sbjct: 208 DAANEYAQILHKR 220 >gb|EUC42499.1| hypothetical protein COCMIDRAFT_103365 [Bipolaris oryzae ATCC 44560] Length = 239 Score = 131 bits (330), Expect = 8e-29 Identities = 64/71 (90%), Positives = 69/71 (97%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREVQPKKEGA+ YTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDA Sbjct: 148 SKEDDVRKFVIRREVQPKKEGARPYTKAPKIQRLVTPQRLQHKRHRLALKRRRAEASKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQILSKR 218 >gb|EME48945.1| hypothetical protein DOTSEDRAFT_67853 [Dothistroma septosporum NZE10] Length = 241 Score = 131 bits (330), Expect = 8e-29 Identities = 68/73 (93%), Positives = 69/73 (94%), Gaps = 2/73 (2%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPK--KEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASK 42 SKEDDVRKFVIRREVQPK KEGAK YTKAPRIQRLVTPQRLQHKRHRIALKRR AEASK Sbjct: 148 SKEDDVRKFVIRREVQPKEGKEGAKPYTKAPRIQRLVTPQRLQHKRHRIALKRRHAEASK 207 Query: 41 DAANEYAKVLHKR 3 DAANEYA+VLHKR Sbjct: 208 DAANEYAQVLHKR 220 >ref|XP_001797870.1| hypothetical protein SNOG_07535 [Phaeosphaeria nodorum SN15] gi|111063881|gb|EAT85001.1| hypothetical protein SNOG_07535 [Phaeosphaeria nodorum SN15] Length = 239 Score = 128 bits (321), Expect = 9e-28 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREV KKEGAK YTKAP+IQRLVTPQRLQHKRHRIALKRRRAEASKDA Sbjct: 148 SKEDDVRKFVIRREVTGKKEGAKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQILQKR 218 >gb|EON67752.1| 40S ribosomal protein S6-B [Coniosporium apollinis CBS 100218] Length = 239 Score = 127 bits (320), Expect = 1e-27 Identities = 63/71 (88%), Positives = 66/71 (92%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREVQPKKEGAK YTKAP+IQRLVTPQRLQHKRHRIALKRRR EA KDA Sbjct: 148 SKEDDVRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRTEAQKDA 207 Query: 35 ANEYAKVLHKR 3 A EYA++L KR Sbjct: 208 ATEYAQILAKR 218 >ref|XP_003836586.1| hypothetical protein LEMA_P041220.1 [Leptosphaeria maculans JN3] gi|312213139|emb|CBX93221.1| hypothetical protein LEMA_P041220.1 [Leptosphaeria maculans JN3] Length = 313 Score = 127 bits (320), Expect = 1e-27 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREV KKEGAK YTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDA Sbjct: 222 SKEDDVRKFVIRREVTSKKEGAKPYTKAPKIQRLVTPQRLQHKRHRVALKRRRAEASKDA 281 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 282 ANEYAQILSKR 292 >gb|EHY57703.1| 40S ribosomal protein S6-A [Exophiala dermatitidis NIH/UT8656] Length = 239 Score = 126 bits (317), Expect = 3e-27 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SK+DDVRKFVIRREV PKKEGAK YTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDA Sbjct: 148 SKQDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQLLAKR 218 >ref|XP_003852989.1| 40S ribosomal protein S6 [Zymoseptoria tritici IPO323] gi|339472871|gb|EGP87965.1| hypothetical protein MYCGRDRAFT_104155 [Zymoseptoria tritici IPO323] Length = 241 Score = 126 bits (316), Expect = 4e-27 Identities = 65/73 (89%), Positives = 68/73 (93%), Gaps = 2/73 (2%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPK--KEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASK 42 SKEDDVRKFVIRREVQPK KEGAK YTKAPRIQRLVTPQRLQHKRHRIALKRR+AE K Sbjct: 148 SKEDDVRKFVIRREVQPKEGKEGAKPYTKAPRIQRLVTPQRLQHKRHRIALKRRQAEKVK 207 Query: 41 DAANEYAKVLHKR 3 +AANEYA+VLHKR Sbjct: 208 EAANEYAQVLHKR 220 >gb|ETI27818.1| 40S ribosomal protein S6-B [Cladophialophora carrionii CBS 160.54] Length = 239 Score = 125 bits (315), Expect = 5e-27 Identities = 62/71 (87%), Positives = 67/71 (94%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SK DDVRKFVIRREV PKKEGAK YTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDA Sbjct: 148 SKNDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQLLAKR 218 >gb|EXJ95055.1| 40S ribosomal protein S6-A [Capronia coronata CBS 617.96] Length = 239 Score = 125 bits (314), Expect = 6e-27 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 +K+DDVRKFVIRREV PKKEGAK YTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDA Sbjct: 148 TKQDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDA 207 Query: 35 ANEYAKVLHKR 3 ANEYA++L KR Sbjct: 208 ANEYAQLLAKR 218 >gb|EMD69198.1| hypothetical protein COCSADRAFT_186166 [Bipolaris sorokiniana ND90Pr] Length = 263 Score = 125 bits (314), Expect = 6e-27 Identities = 65/79 (82%), Positives = 69/79 (87%), Gaps = 8/79 (10%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SKEDDVRKFVIRREVQPKKEGAK YTKAP+IQRLVTPQRLQHKRHR+ALKRRRAEASKDA Sbjct: 164 SKEDDVRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRLALKRRRAEASKDA 223 Query: 35 A--------NEYAKVLHKR 3 A NEYA++L KR Sbjct: 224 ANERLTTWQNEYAQILSKR 242 >gb|EXJ88970.1| 40S ribosomal protein S6-B [Capronia epimyces CBS 606.96] Length = 239 Score = 125 bits (313), Expect = 8e-27 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 +K+DDVRKFVIRREV PKKEGAK YTKAP+IQRLVTPQRLQHKRHRIALKRRRAEA+KDA Sbjct: 148 TKQDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEAAKDA 207 Query: 35 ANEYAKVLHKR 3 ANEY+++L KR Sbjct: 208 ANEYSQLLAKR 218 >ref|XP_002835429.1| 40S ribosomal protein S6 [Tuber melanosporum Mel28] gi|295629210|emb|CAZ79586.1| unnamed protein product [Tuber melanosporum] Length = 214 Score = 125 bits (313), Expect = 8e-27 Identities = 62/71 (87%), Positives = 66/71 (92%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 +K+DDVRKFVIRREVQPK EG K YTKAP+IQRLVTPQRLQHKRHRIALKRRRAEASKDA Sbjct: 117 NKDDDVRKFVIRREVQPKDEGKKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAEASKDA 176 Query: 35 ANEYAKVLHKR 3 ANEYA +L KR Sbjct: 177 ANEYAALLAKR 187 >gb|EXJ63909.1| 40S ribosomal protein S6-B [Cladophialophora yegresii CBS 114405] Length = 239 Score = 124 bits (312), Expect = 1e-26 Identities = 61/71 (85%), Positives = 67/71 (94%) Frame = -3 Query: 215 SKEDDVRKFVIRREVQPKKEGAKSYTKAPRIQRLVTPQRLQHKRHRIALKRRRAEASKDA 36 SK DDVRKFVIRREV PKKEGAK YTKAP+IQRLVTPQR+QHKRHRIALKRRRAEA+KDA Sbjct: 148 SKNDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPQRMQHKRHRIALKRRRAEAAKDA 207 Query: 35 ANEYAKVLHKR 3 AN+YA++L KR Sbjct: 208 ANDYAQLLAKR 218